KEGG   Cycloclasticus zancles: CYCME_0890Help
Entry
CYCME_0890        CDS       T02780                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cza  Cycloclasticus zancles
Pathway
cza00020  Citrate cycle (TCA cycle)
cza00480  Glutathione metabolism
cza01100  Metabolic pathways
cza01110  Biosynthesis of secondary metabolites
cza01120  Microbial metabolism in diverse environments
cza01130  Biosynthesis of antibiotics
cza01200  Carbon metabolism
cza01210  2-Oxocarboxylic acid metabolism
cza01230  Biosynthesis of amino acids
Module
cza_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cza_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CYCME_0890 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CYCME_0890 (icd)
Enzymes [BR:cza01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CYCME_0890 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF3221
Motif
Other DBs
NCBI-ProteinID: AGS39223
UniProt: S5TW48
LinkDB All DBs
Position
877245..879491
Genome map
AA seq 748 aa AA seqDB search
MHGERMTVKKSKIIYTLTDEAPLLATASFLPIVEAFAGAAGIDVEVSDISLASRVLATFA
DQLPDDQKVPDALSELGRLTQNPETNIIKLPNISASVPQLKAIINELQGKGFDIPNYPED
PQTDEEKALQQKYGKVLGSAVNPVLREGNSDRRAPKAVKEYAKKNPHSMGKWSQASRTHV
SHMRSGDFYSSEKSLTLDKACKVNIEFVAKNGEVTVLKKGLALQEGEIIDSMFMSKKQLC
AYLEDEMNDAKETGVMFSFHVKATMMKVSHPIVFGHAVKVYYKDLFEKHGKLFDELGVNP
NDGLSSVYEHIEKLPASIKEEILSDMHACYEKRPELAMVDSAKGISNLHTPNEVIVDASM
PAMIRAGGKMWGPDGKMKDTKAVMPESTFARIYQEIINFCKTHGEFDPTTMGTVPNVGLM
AQKAEEYGSHDKTFEMKADGSTRIVDEEGNVLLEMDVEEGDIWRMCQVKDAPIQDWVKLA
VKRARLSNTPAVFWLDKYRPHENELIKKVEKYLKDHDLTGVDIKIKSQTRAMRYTLERIL
RGKDTISVTGNILRDYLTDLFPILELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVKQL
IEENHLRWDSLGEFLALCASLEHTAISDGNAKAAVLAKTLDEATAKLLDTGKSPSRKTGE
LDNRGSHFYLALYWAQALAEQTEDEALQTHFQPLAASLTENEEKIVGTLTTEQWHAVDIG
GYYKPDVDKVREVMRPSEIFNEALASLK
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgcacggagagagaatgactgtcaaaaagtccaaaattatttatacgttaacggatgaa
gcgcctttattagcgactgcttcatttcttcctattgttgaagcgttcgcaggagcagct
ggcattgacgttgaggtgagtgatatctcgttagcgtctagagtgcttgctacgtttgct
gatcagctacctgatgatcaaaaggtccccgatgcattgtctgaattaggacgtttaacg
caaaatcccgagacgaacattatcaaattaccgaatatcagtgcatcggttcctcagtta
aaagcaattattaatgagttgcagggaaagggttttgatattccaaattatccagaagat
cctcaaactgatgaggaaaaagctcttcaacaaaagtacggtaaagtgttaggaagtgcg
gttaacccggtactacgcgagggtaactctgatcgtcgcgcacctaaggcagttaaagaa
tatgccaagaaaaacccacactctatgggtaagtggagtcaggcgtctagaacacacgtt
tctcatatgcgctcaggtgacttttattctagtgagaaaagcttaacgctggacaaagca
tgcaaggtgaacattgaatttgttgctaagaatggtgaggtcaccgtattaaagaagggt
ttagcgctacaagaaggtgaaatcatagacagtatgtttatgagcaagaagcaattgtgt
gcgtatctagaagatgaaatgaacgacgcgaaagaaaccggtgtgatgttttcatttcat
gtaaaagcgaccatgatgaaagtgtctcatcctattgtttttggacacgcggtaaaagtg
tattacaaagacttgtttgaaaaacatggcaagctgtttgatgaattaggtgttaaccct
aatgatggtttgagcagtgtttatgaacatattgagaagctacctgcatcgattaaagaa
gaaattcttagtgatatgcatgcctgttacgaaaagcgcccagagcttgctatggtggat
tccgctaaagggatttctaacctacatacgcctaatgaggtgattgttgatgcatcaatg
cctgcaatgattcgcgcaggcggcaaaatgtggggccctgacggtaaaatgaaagacacg
aaagcagtgatgccggagagtactttcgctcgaatttatcaagaaataatcaatttttgt
aaaacgcatggtgagtttgacccaaccacaatgggaacagtccccaatgttggcctaatg
gctcaaaaagctgaagaatatggttcccatgataaaacctttgagatgaaggcggatggc
agcacccgtattgttgatgaagaaggcaatgtcttacttgaaatggatgttgaagaaggt
gatatatggagaatgtgccaagttaaagatgcacctattcaagactgggtgaaattggct
gtgaagcgcgcacgtttatcaaatacgccggctgttttttggttagataagtaccgtccg
cacgaaaatgaattgattaaaaaagttgaaaagtaccttaaagatcatgatctaactggc
gtagatattaaaattaagtcgcaaacaagagcgatgcgttacacacttgagcgtatttta
cgtggtaaagatacaatttctgtgacgggtaatattttgcgtgattacttaaccgatcta
tttccgattcttgagttagggaccagtgcaaagatgttgtctatcgtgccgcttatggca
ggcggtggtttatttgaaacgggtgcaggtggttcagcgcctaagcatgttaaacaattg
atagaagaaaatcatttacgttgggattcgctaggtgagtttttagctctgtgcgcttca
cttgagcatacagcgatatcagatggcaatgcgaaggcagctgtgttggcaaaaacatta
gatgaagcaacggctaaattactcgatactggcaaatcgccgtcacgtaaaacaggggag
cttgataaccgtggtagtcacttttaccttgcgttgtattgggcacaggcacttgctgaa
cagacagaagatgaagccttacaaactcattttcagccattagcagcatcactaactgag
aatgaagagaaaattgttggtacattaactacagagcagtggcatgcagtagacattggt
ggttattacaagccagatgttgataaagtgcgtgaggttatgagaccttcagagatattt
aatgaggcgcttgcttcattgaaataa

DBGET integrated database retrieval system