KEGG   Cycloclasticus zancles: CYCME_1637
Entry
CYCME_1637        CDS       T02780                                 

Definition
(GenBank) Carbazole dioxygenase subunit
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
cza  Cycloclasticus zancles
Pathway
cza00621  Dioxin degradation
cza01100  Metabolic pathways
cza01120  Microbial metabolism in diverse environments
cza01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cza00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CYCME_1637
Enzymes [BR:cza01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     CYCME_1637
SSDB
Motif
Pfam: Aromatic_hydrox Rieske VanA_C
Other DBs
NCBI-ProteinID: AGS39962
UniProt: S5TGG8
LinkDB
Position
complement(1646204..1647376)
AA seq 390 aa
MDQSERILVNEEVVKKNKLWPNFIKAKLGFRNHWYPVMFGKEIEEGKPVKAMLCGENLLL
NRIDGKVYAIKDRCLHRGVAFSKKPECYTKETITCWYHAWTYRWDDGSLCDIMTDPKSDM
IGKHRLKTYTVQEAKGLVFIFLGDIEPTPLINDVPPGFLDEGRAIRGIKREVGSNWRIAA
ENGFDSTHVFIHKDSKLIPNNETVIPLGFATDREEEAKGTLWEVVNNEDGPKGVYDNIGQ
HAVPVVEGKVDGETVLRPVIGGDKRIANQISIWMPGALKVDPFPDPSLIQFEWYVPRDEN
SHWYIQTLGKEVANEAEELEFEKDFNEKWEDWGLRGFNDDDIWAREAMEEFYKDDWGWIK
EQLFEPDGNIVAWRQLASEANRGVQTLEDL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggatcaaagtgaaagaattttagtcaacgaagaggtcgtgaaaaagaacaagttatgg
ccgaactttattaaggccaagctggggtttagaaaccattggtaccccgtcatgttcggt
aaagaaatagaagagggcaagcctgttaaggcgatgttatgtggtgaaaacctattactc
aaccgaattgatggaaaagtttatgccatcaaagataggtgtttacaccgaggtgttgcc
ttttctaaaaagcctgagtgttatacaaaagagaccattacctgttggtatcatgcttgg
acgtatcgatgggacgatggctcgttatgcgacattatgacggaccctaaaagcgatatg
attggtaagcatcgtcttaaaacgtacactgtgcaagaagcaaaagggcttgtatttatt
tttctcggcgatattgaacctacccctctgattaatgacgtaccacctgggtttttagat
gaagggcgtgcgattagaggcattaaacgagaagttgggtcaaactggagaattgctgct
gaaaatggttttgattcaacacatgtttttattcataaagacagtaagttaataccaaac
aatgagaccgttattccattagggtttgcgacagatcgtgaagaagaagcaaaaggcacc
ttatgggaagtagttaataacgaagacggacctaagggtgtttacgataatatcggccag
catgcggttcccgtcgttgagggtaaagtagatggtgaaacagttcttcgtccggttatt
ggtggtgataaacgcatagccaaccaaatctcaatatggatgccaggcgcccttaaagta
gacccctttccagacccttcattgattcaatttgaatggtatgtgccaagagatgaaaac
tcacattggtatattcaaacgcttggtaaagaagtggctaatgaagctgaagagctagag
tttgaaaaagattttaatgaaaagtgggaagactgggggctacgtggctttaatgatgat
gatatttgggcccgtgaagcgatggaagagttttacaaggatgactggggttggattaaa
gaacagttatttgagccagatggaaatatagtcgcgtggagacagttagccagtgaagca
aatcgcggtgtccaaacactagaagatttataa

DBGET integrated database retrieval system