KEGG   Defluviimonas alba: AKL17_0212Help
Entry
AKL17_0212        CDS       T04387                                 

Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
daa  Defluviimonas alba
Pathway
daa00630  Glyoxylate and dicarboxylate metabolism
daa01100  Metabolic pathways
daa01120  Microbial metabolism in diverse environments
daa01200  Carbon metabolism
Module
daa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
daa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:daa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AKL17_0212
Enzymes [BR:daa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AKL17_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AMY67474
UniProt: A0A159Z0Q9
LinkDB All DBs
Position
complement(203392..204849)
Genome map
AA seq 485 aa AA seqDB search
MNTQTEIKGKDRYKAGVLKYAQMGYWDGDYQPKDTDLLALFRITPQEGVDPIEAAAAVAG
ESSTATWTVVWTDRLTACDQYRAKAYKVEPVPSTPGQFFCYVAYDLILFEEGSIANLTAS
IIGNVFSFKPLKAARLEDMRLPVAYVKTFRGPPTGIVVERERLDKFGKPLLGATTKPKLG
LSGKNYGRVVYEGLRGGLDFMKDDENINSQPFMHWRDRFLYVMEAVNLASAQTGEVKGHY
LNITAGTMEEMYRRAEFAKQLGSCIVMVDLIIGWTAIQSISEWCRQNDMILHMHRAGHGT
YTRQKNHGISFRVIAKWLRLAGVDHLHTGTAVGKLEGDPMTVQGYYNVCRETRNEVDLQR
GIFFEQDWGDIKKVMPVASGGIHAGQMHQLLSLFGDDVVLQFGGGTIGHPMGIQAGATAN
RVALEAMVLARNEGRNIDVEGPEILRAAAKWCKPLEAALDTWGNITFNYTSTDTSDFVPT
ASVAM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcagacagagatcaagggcaaggaccgctacaaggcgggcgtgctgaaatac
gcgcagatgggctattgggatggcgactaccagcccaaggacaccgacctgctggcactg
ttccgcatcaccccgcaagagggcgtcgatccgatcgaggccgccgccgcggtggcgggc
gaaagctccaccgcgacctggacggtggtctggaccgaccggctgaccgcctgcgaccag
taccgcgccaaggcctacaaggtcgaacccgtgccgagcacgccggggcagttcttctgc
tatgtcgcctatgacctgatcctgttcgaggaaggctccatcgccaacctgacggccagc
atcatcggcaacgtcttcagcttcaagccgctgaaggccgcccggctggaggacatgcgc
ctgccggtcgcctatgtgaagaccttccgcggcccgcccaccggcatcgtggtggaacgc
gagcggctggacaagttcggcaagccgctgctgggggccacgaccaagcccaagctgggc
ctgtcgggcaagaattacgggcgcgtggtctatgaagggctgcgcggcgggctcgacttc
atgaaggatgacgagaacatcaactcgcagcccttcatgcattggcgcgaccgcttcctc
tatgtgatggaggcggtgaacctcgcctcggcccagaccggcgaggtgaagggccattac
ctcaacatcaccgccggcacgatggaagagatgtaccggcgggccgaattcgccaagcag
cttggctcctgcatcgtgatggtagacctcatcatcggctggaccgcgatccagtcgatc
agcgaatggtgccgccagaacgacatgatcctgcacatgcaccgcgccgggcatggcacc
tatacccggcagaagaaccacggcatcagcttccgcgtcatcgccaaatggcttcggctg
gcgggggtggaccatctgcacaccggcaccgccgtcggcaagctggaaggcgatccgatg
accgtgcagggctattacaacgtctgccgcgagaccaggaacgaggtcgaccttcagcgc
gggatcttcttcgaacaggactggggcgacatcaagaaggtgatgcccgtcgcctcgggc
ggcatccatgccgggcagatgcaccagctgctcagcctctttggcgacgatgtggtactg
cagttcggcggcggcaccattggccatccgatgggtatccaggccggcgccaccgccaac
cgcgtcgcgctggaagcgatggtgctggcccgcaacgagggccgcaacatcgacgtcgaa
ggccccgagatcctgcgcgccgccgccaagtggtgcaagccgctggaggccgcgctcgat
acctggggcaacatcaccttcaactacacctccaccgacacgtcggacttcgtgccgacc
gcctcggtcgccatgtaa

DBGET integrated database retrieval system