KEGG   Defluviimonas alba: AKL17_0388Help
Entry
AKL17_0388        CDS       T04387                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
daa  Defluviimonas alba
Brite
KEGG Orthology (KO) [BR:daa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AKL17_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AMY67650
UniProt: A0A159Z142
LinkDB All DBs
Position
381840..382598
Genome map
AA seq 252 aa AA seqDB search
MMGGLEIWAFVLALGVTFFGGFVKGAVGFAMPLIMVSVLSSFLTHDMVLASVMLPVLVTN
LSQCLRDGWRAAAKTAWQYRRMIGVMLAFILISAQFVDAIPQRLLTLLLGVPITLFALVQ
LLGIPLALRLEHRARAEVVLGVIGGFYGGIAGIWGPPLIVYLLSINAEKREAMRVQGVFF
FLGSIVLLAGHAISGLLTPSMLVFSGSLVVPAVAGMALGYAVHDRLPAATFRRWTQGLLV
LTGLNLVREALV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtggactggagatctgggcattcgtgctcgccctcggcgtgacgttctttggc
ggcttcgtgaagggtgcggtgggcttcgccatgccgctcatcatggtgtcggtgctcagt
tccttcctgacgcatgacatggttctggcctcggtgatgctgccggtgctggtgaccaac
ctgtcgcaatgccttcgggacggatggcgtgctgctgccaagacggcgtggcagtatcgg
cggatgatcggggtaatgttggccttcatcctgatttcggcccagttcgtcgatgcgatc
ccgcagcggttgctgaccttgcttctgggtgtgccgatcacgctgttcgcgctggtgcaa
ctgctgggcatcccgctggcgctgcggctggagcaccgggcgcgtgccgaggtggtgctg
ggggtcattggcggcttctatggagggatcgccgggatctgggggccgccgctgatcgtc
tacctgctgtcgatcaatgccgagaagcgcgaggcgatgcgggtgcagggggtgttcttc
ttcctcggatctatcgttctgctggcggggcatgccatctcgggcttgctgacgccgtcg
atgctggtcttctcgggctcgctggtggtgccggcggtggcgggcatggcgcttggctat
gcggtgcatgaccggcttccggcggcgacgttccgccgctggacccagggcctgctggtg
ctgaccggtttgaaccttgtgcgcgaggcgctggtctag

DBGET integrated database retrieval system