KEGG   Defluviimonas alba: AKL17_0408Help
Entry
AKL17_0408        CDS       T04387                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
daa  Defluviimonas alba
Brite
KEGG Orthology (KO) [BR:daa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:daa03012]
    AKL17_0408
   03029 Mitochondrial biogenesis [BR:daa03029]
    AKL17_0408
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:daa04147]
    AKL17_0408
Translation factors [BR:daa03012]
 Eukaryotic Type
  Elongation factors
   AKL17_0408
 Prokaryotic Type
   AKL17_0408
Mitochondrial biogenesis [BR:daa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AKL17_0408
Exosome [BR:daa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AKL17_0408
  Exosomal proteins of breast cancer cells
   AKL17_0408
  Exosomal proteins of colorectal cancer cells
   AKL17_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AMY67670
UniProt: A0A159Z166
LinkDB All DBs
Position
401669..402844
Genome map
AA seq 391 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGDFRAYDQIDGAPEERARGITIST
AHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVCAASDGPMPQTREHILLGRQ
VGIPFMVCYMNKIDLVDDEELVELVEMELRELFSSYEYPGDDIPIIKGSAHQAMIGERKD
IGEDSIRALLKAVDEYIPTPARAIDQPFLMPIEDVFSISGRGTVVTGRIERGVINVGDEV
EIIGIKATQKSVCTGVEMFRKLLDRGEAGDNVGVLLRGIDREAVERGQVLCKPKSVNPHT
HFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVKLPEGTEMVMPGDNLKFEVEL
IAPIAMEEKLRFAIREGGRTVGAGVVSKILK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcaaagtttgaacggaacaaaccgcacgtcaacatcggcacgattggccac
gttgaccacggcaagacgactctgacggcggcgatcacgaagtatttcggcgacttccgg
gcctatgaccagatcgacggtgcgccggaagagcgtgctcgcgggatcacgatctcgacg
gcgcatgtggaatacgagaccgagaaccggcactatgcgcatgtggactgccccggccac
gccgactatgtgaagaacatgatcaccggcgcggcgcagatggacggcgcgatcctggtc
tgtgcggcctcggacgggccgatgccgcagacgcgcgagcacatcctgctcggccgccag
gtcggcattccgttcatggtgtgctacatgaacaagatcgacctggtggatgatgaagag
ctggtcgagctggtggagatggaacttcgcgagctgttctcgtcctacgaataccctggc
gacgacatcccgatcatcaagggctctgcgcaccaggcgatgatcggcgagcgcaaggat
atcggcgaggattcgatccgggcgctgctgaaggcggttgacgagtacatcccgacgccg
gcgcgtgcgatcgaccagccgttcctgatgccgatcgaggacgtgttctcgatctcgggg
cgcggcacggttgtgaccgggcggatcgagcgcggtgttatcaacgtcggcgacgaggtc
gagatcatcgggatcaaggcgacgcagaaatcggtctgcaccggggtcgagatgttccgc
aagctgctggaccgcggcgaggctggcgacaacgtgggcgttctgctgcgcggcatcgac
cgtgaggcggtggaacgtgggcaggtgctgtgcaagccgaaatcggtgaacccgcacacg
catttcgaagccgaggcctatatcctgaccaaggaagagggcggccgccacactccgttc
ttcgccaactaccgcccgcagttctacttccgcacgaccgacgtgaccgggaccgtgaaa
ctgccggaaggcaccgagatggtgatgccgggcgacaacctgaagttcgaggtcgaactg
atcgccccgatcgcgatggaagaaaaactgcgcttcgccatccgcgaaggcggccgcacc
gtcggcgcaggcgtcgtgtcgaaaatcctgaagtaa

DBGET integrated database retrieval system