KEGG   Defluviimonas alba: AKL17_0977Help
Entry
AKL17_0977        CDS       T04387                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
daa  Defluviimonas alba
Pathway
daa00240  Pyrimidine metabolism
daa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AKL17_0977
Enzymes [BR:daa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AKL17_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AMY68236
UniProt: A0A159Z039
LinkDB All DBs
Position
complement(940899..941480)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFHYSTMNAGKSTILLQASHNYHERGMQTYLLTARFDNRAGPGRIASRIGIGTEAD
CFDASSDMFEKIKDRLASGPCACVFVDEAQFLAPAQVWQLARAVDDLGVPIMCYGLRVDF
RGELFPGSAALLALADEMREVRTICHCGRKATMVVRRDSAGRVVMSGDQVQIGGNETYES
LCRRHWRIATGDA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgtatttccactactcgacgatgaatgccgggaaatccacgatcctgctg
caggcatcgcacaactaccacgaacgcgggatgcaaacctatctgctgaccgcgcgtttc
gacaatcgcgccggccccggccgtatcgccagccgcatcggcatcggcaccgaggcggat
tgcttcgacgcgtcctcggatatgttcgaaaagatcaaggatcggctcgcctcggggccc
tgcgcatgcgtttttgttgatgaagcacaattcctggcccccgcgcaggtctggcagctt
gcccgcgccgtcgatgatctgggcgtaccgatcatgtgctacgggctgcgcgtcgatttc
cgcggcgagctgttccccggctctgctgccctgctggccctggccgacgagatgcgcgag
gttcgcaccatctgccattgcgggcgcaaggccacgatggtggtgcgccgggacagcgcg
ggccgggtggtcatgtcgggcgatcaggtgcagatcggcggcaacgagacctatgaatcg
ctctgccgccgccattggcgcatcgccaccggcgacgcatga

DBGET integrated database retrieval system