KEGG   Defluviimonas alba: AKL17_1636Help
Entry
AKL17_1636        CDS       T04387                                 

Definition
(GenBank) transcriptional regulator, AraC family
  KO
K07506  AraC family transcriptional regulator
Organism
daa  Defluviimonas alba
Brite
KEGG Orthology (KO) [BR:daa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:daa03000]
    AKL17_1636
Transcription factors [BR:daa03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    AKL17_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC Cupin_6 AraC_binding AraC_binding_2 AraC_N
Motif
Other DBs
NCBI-ProteinID: AMY68888
UniProt: A0A159Z3S3
LinkDB All DBs
Position
1600669..1601475
Genome map
AA seq 268 aa AA seqDB search
MFVQVYSRNNTQQPFLVPAVAEPLIVWVIAGEAIVEEREMDGEWRAAHVRVGDFFLTHSP
MPYELRWQAKGDTPFKVMHLYLATPLFERVASEVLGTHVPTALGEISGERDDQLSALLTL
IHHELETEAPGSQLFVQGLAQSLAVHLARNYASRAPGISRTTALPGFKLRRAVAYLETHL
AEPFNLALLAETVGMSAFHFSRLFKKATGLSPSRYFIRQRIAKAQQLLQETEASVIEVGM
SVGYSSPSHFAQVFRRETGLSPSHYRRV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtgcaggtctattcgaggaacaacactcagcagccgtttctcgtcccggccgtg
gccgaaccgctgatcgtttgggtcatcgccggagaggcgatcgtcgaagagcgcgagatg
gacggggaatggcgcgccgcgcatgtccgcgtgggcgacttctttctcacccattcgcca
atgccatacgaactgaggtggcaggcgaagggcgacaccccgttcaaggtcatgcacctc
tatcttgccaccccccttttcgagcgcgtcgcatccgaggttcttggcactcacgtgccc
acggcgctcggcgagatatcgggtgaacgggatgaccagctgtcagcccttctgacgctg
atccaccatgagcttgaaaccgaggcaccgggcagccaactgttcgtccagggccttgcc
cagagcctggcggtccacctggcccgaaactatgcatcgcgcgcacctggcatcagcagg
acgaccgcgctgcccggcttcaagttgcggcgggccgtcgcctatcttgaaacccacctg
gccgagcctttcaacctagccctgctggctgaaaccgtcggcatgagcgccttccatttc
agccgcctgttcaagaaggcgacggggctgtccccttcgcgctacttcatccgccagcgc
atagcgaaggcgcagcaactcttgcaggaaaccgaggccagcgtcattgaggtcgggatg
tccgtcggctattcaagccccagccacttcgcccaggtcttccggcgcgagacgggcctg
tcgcccagtcactaccgacgcgtctga

DBGET integrated database retrieval system