KEGG   Defluviimonas alba: AKL17_2036Help
Entry
AKL17_2036        CDS       T04387                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
daa  Defluviimonas alba
Pathway
daa00250  Alanine, aspartate and glutamate metabolism
daa00410  beta-Alanine metabolism
daa00640  Propanoate metabolism
daa00650  Butanoate metabolism
daa01100  Metabolic pathways
daa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:daa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AKL17_2036
   00650 Butanoate metabolism
    AKL17_2036
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AKL17_2036
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AKL17_2036
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:daa01007]
    AKL17_2036
Enzymes [BR:daa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AKL17_2036
Amino acid related enzymes [BR:daa01007]
 Aminotransferase (transaminase)
  Class III
   AKL17_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMY69283
UniProt: A0A165SLW2
LinkDB All DBs
Position
complement(2024349..2025638)
Genome map
AA seq 429 aa AA seqDB search
MTHSTITDAALSARRTAAIARGVGVTTQVYADRAENAEIWDKTGTRYIDFAAGIAVVNTG
HRHPRVIAAVKAQLDRFTHTCHQVVPYENYVTLAERLNDKVPGDFAKKTLFATTGAEAVE
NAVKIARHHTGRAAVIAFAGGFHGRTFMGMALTGKVQPYKAGFGPMMADVWHLPFPVALQ
GVTAEDSLAALDRLFKADLEPTRVAAILVEPVQGEGGFYEVPAGFMASLRAICDTHGIVL
IADEVQTGFARTGKLFAMEHHGVAADITTMAKGLGGGLPISAVTGRAEIMDSPNPGGLGG
TYAGNPLAIAAANAVLDVIEEEQLCDRAMRLGQRLKQRLAGLQEAVPQIADIRGPGFMNA
VEFAVPGTGAPDAGFANRVREEALSRGLILLTCGVYGNVIRFLAPLTIPDAVFDEALEIL
EASVLAARG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacccacagcacgatcaccgacgccgccctttcggcccgccgcaccgccgccatcgcc
cgcggtgtcggcgtcaccacgcaggtctatgctgaccgggccgagaatgcggaaatctgg
gacaagaccggcacccgctatatcgacttcgccgccggcatcgcggtggtgaataccggc
caccgccatcccagggtgatcgccgcggtcaaggcgcagctcgaccgcttcacccatacc
tgccaccaggtcgtgccctacgagaattacgtgaccctggccgagcggctgaatgacaag
gtgccgggcgattttgccaagaagaccctcttcgccaccaccggcgccgaggcggtggag
aacgcggtgaagatcgcccgccatcacaccgggcgcgccgccgtcatcgccttcgcgggg
ggctttcacggccgcaccttcatgggcatggcgctgaccggcaaggtgcagccctacaag
gccggcttcggcccgatgatggccgatgtctggcacctgccgttcccggtcgcgctgcaa
ggggtcaccgccgaggactcgctcgcggcgctcgaccgcctgttcaaggccgaccttgag
ccgacccgtgtggcggcgatcctggtcgagccggtgcagggcgagggcggcttctacgag
gttccggccggcttcatggccagcttgcgcgccatttgcgacacgcatggcatcgtgctg
atcgccgatgaggtgcagaccggctttgcccgcaccggcaagctgtttgcgatggagcat
cacggggtcgccgccgatatcaccacgatggccaagggccttggcggcggcctgccgatt
tcggcggtgacgggccgggccgagatcatggacagccccaaccccggcggtctgggcggc
acctacgccggcaacccgctggccatcgccgccgccaatgcggtgctggacgtgatcgag
gaggaacagctttgcgaccgcgccatgcgccttggccagcggctgaaacagcggctggcg
gggctgcaggaggcggtgccgcagatcgccgatatccgcggcccgggcttcatgaatgcg
gtggaattcgcggtgcccggcaccggcgcccccgatgccgggtttgcgaaccgggtgcgc
gaggaggcgctgtcgcgcggcctgatcctgctgacctgcggtgtctatggcaatgtgatc
cgcttccttgcgccgctaaccatccccgacgcggtattcgacgaggcgctggagatcctg
gaagcctcggtgctcgccgcgcgcggctga

DBGET integrated database retrieval system