KEGG   Defluviimonas alba: AKL17_2987Help
Entry
AKL17_2987        CDS       T04387                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
daa  Defluviimonas alba
Pathway
daa00061  Fatty acid biosynthesis
daa00780  Biotin metabolism
daa01100  Metabolic pathways
daa01130  Biosynthesis of antibiotics
daa01212  Fatty acid metabolism
Module
daa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:daa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AKL17_2987
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AKL17_2987
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AKL17_2987
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:daa01004]
    AKL17_2987
Enzymes [BR:daa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AKL17_2987
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AKL17_2987
Lipid biosynthesis proteins [BR:daa01004]
 Fatty acid synthase
  Component type
   AKL17_2987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AMY70221
UniProt: A0A159Z4T6
LinkDB All DBs
Position
2964267..2965031
Genome map
AA seq 254 aa AA seqDB search
MFSLTGQKVLVVGIANENSIAWGCAKAFRAQGADLAVTYLNAKAEPHVRPLAEALGAEII
APLDVSDPAQMPALFAQIGARWGRLDTALHSIAFAPRNDLHGRVIDCSAEGFAQAMDVSV
HSFLRMIRLAEPLMSEGGTCLSVSFFGASRVVRHYNLMGPVKAALESAVRYAATELGPQR
ITVHALSPGPLKTRAASGIDHFDELLDTAAARAPTHQLATIEDVGAMAAFLASPGARNLT
GGIHDIDGGYSITA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgttttcccttaccggacagaaggtgcttgtcgtcggcatcgccaatgaaaactccata
gcctggggctgcgccaaggccttccgcgcccagggcgccgacctggcggtgacctatctc
aatgccaaggccgagccccatgtccgcccgctggccgaggcacttggggccgagatcatt
gcgcccctcgacgtgtccgacccggcgcagatgccggcgctgttcgcccagatcggcgcc
cgctggggccggctcgacactgccctgcactccatcgctttcgccccgcggaacgatcta
cacgggcgagtgatcgattgttccgccgaaggctttgcgcaggcgatggatgtgtcggtg
cactcgttcctgcggatgatccggctggccgagccgctgatgtcggagggtggcacctgc
ctgtcggtgtcattcttcggggcatcgcgggtggtgcggcattacaacctgatggggccg
gtcaaggcggcgctggaaagcgccgtgcgctatgcggcgacagagcttggcccgcagcgc
atcacggttcatgcgctgtcccccggaccgctgaaaacgcgcgcggccagcgggatcgac
cattttgacgaattgctggacaccgccgccgcccgggcgccgacccatcagcttgccacc
atcgaggatgtgggcgcgatggccgccttcctggcctcgcccggtgcgcgcaacctaacg
ggtggcatccacgatattgacggcggctattcgatcaccgcgtga

DBGET integrated database retrieval system