KEGG   Defluviimonas alba: AKL17_4782Help
Entry
AKL17_4782        CDS       T04387                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
daa  Defluviimonas alba
Pathway
daa00564  Glycerophospholipid metabolism
daa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:daa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AKL17_4782
Enzymes [BR:daa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AKL17_4782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_binding_3 Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AMY71992
UniProt: A0A159Z8W9
LinkDB All DBs
Position
4726957..4728495
Genome map
AA seq 512 aa AA seqDB search
MSDHAPARRVDLAIIGGGINGCGIARDAVGRGYSVWLCEQGDLGGATSSSSTKLLHGGLR
YLEHHEFRLVREALIEREVLWGIAPQIVRPLRFILPHRKGMRPAWLLRLGLFIYDHLGGR
KLLPGTSRVNLAQGPYGEGLNADLRLGFEYSDCWVEDNRLTILNAQDAAERGAEIRVRTR
CTEARPLPGGGWRVVGRDLETGAEEVVHARMVINAGGPWANAVARDLVQRPPKGSVRQVQ
GSHIVVPRLYGHDRCFIFQNADGRIVFTIPYEDRFTLIGTTDRDYPGDPAKVAASDEEIA
YLCALVGQYFKRPITPKDVVWSYSGVRPLYDDGSSEAQKATRDYVLELDQAEGAPVLSVF
GGKITTYRRLAESALERIEATLGRAQGEPAGWTGQHPLPGGGFAPRGFDAEVRKLISARS
FLTGAEATRLVRFYGTRAAEMLGDARSRADLGRDFGAGLTEREVEYMCRTEWARTAEDIL
FRRSKLGLRLTPAQIAGLEDHLRKDMQLRMTA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccacgcacccgcgcgcagggtcgacctggcgatcatcggcggcggcatcaac
ggctgcgggattgcccgcgatgcggtgggccggggatattcggtctggctgtgcgagcag
ggtgatcttggcggcgcgacctcgtcctcctcgaccaagctgctgcatggcggcctgcgc
tatctggagcatcatgaattccgcctggtgcgcgaggcgttgatcgagcgcgaggtgctt
tggggcatcgccccgcagatcgtgcgcccgctgcgcttcatcctgccgcatcgcaaggga
atgcgcccggcctggctgctgcggttggggctgttcatctatgaccatctggggggccgc
aagctgctgccgggcacgtcgcgggtgaacctggcgcaggggccgtatggcgaggggctg
aatgccgatctgcggctggggttcgagtattccgactgctgggtcgaggataaccgcctg
acaattctcaacgcgcaggacgcggcagagcgaggcgccgagatccgcgtgcgtacccgc
tgcaccgaggcgcggcccttgccgggcggcggctggcgcgtggtgggccgcgatctggaa
accggcgcggaagaggtggttcatgcccgcatggtcatcaacgccggcggcccctgggcc
aatgccgtggcgcgcgatctggtgcagcgcccgcccaagggctcggtccggcaggtgcag
gggtcgcatatcgtggtgccgcggctctatggccatgaccgctgcttcatcttccagaat
gcggatgggcggatcgtctttaccattccctatgaggaccgctttaccctgatcggcacc
accgaccgcgactatcccggcgatccggccaaggtcgcggcctcggacgaggagatcgcc
tatctttgcgcgctggtcgggcagtatttcaagcgcccgatcacgcccaaggatgtggtg
tggagctattccggtgtgcgcccgctctatgacgatggcagctccgaggcgcagaaggcc
acgcgcgattatgtgctggagctggatcaggccgagggcgccccggtgctgtcggtgttc
ggtggcaagatcacgacctatcggaggctggcggagtccgcgttggagcggatcgaggcc
accttgggccgcgcacagggcgagcccgccggctggacggggcagcatccgctgccggga
ggcggctttgcgccgcggggcttcgacgcagaagtgcgcaagctgatctcggcccgcagc
ttcctgaccggcgccgaggcgacccgactggtacgcttctacggcacccgcgcggccgag
atgctgggcgatgcccgcagccgtgccgatctgggccgcgacttcggcgcgggactgacg
gagcgcgaggtggagtacatgtgccgcaccgaatgggcgcgcaccgccgaggacatcttg
ttccgccgcagcaagctggggctgcggctgacgccagcccagatcgcgggactggaagat
cacctgcgaaaggatatgcaactacgaatgacggcatga

DBGET integrated database retrieval system