KEGG   Deinococcus actinosclerus: AUC44_04325Help
Entry
AUC44_04325       CDS       T04259                                 

Definition
(GenBank) 3-oxoacyl-ACP reductase
Organism
dab  Deinococcus actinosclerus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR DFP Big_6 Sacchrp_dh_NADP Pyr_redox HHH_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALW88215
UniProt: A0A0U4BXN7
LinkDB All DBs
Position
897556..898302
Genome map
AA seq 248 aa AA seqDB search
MTILDLFRLDGRHALITGGAQGIGFEIARGLAQAGARVTIADLNPNVGQTAAATLAGQFE
VLNVTDAAAVAALARRLPDVDILVNNAGIVRNTPAEATPDDDWRSVIDVNLNGVYWCCRE
FGRAMLERGQGSIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWAPRGVRVNC
VAPGYTATPLTRRGLETPEWRETWLKETPMGRLAEPAEIAPAVLYLASEAASFVTGHALV
VDGGYTCW
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcctcgaccttttccgcctggacggccgccacgccctgatcaccgggggcgcg
cagggcatcggcttcgagatcgcccggggcctcgcgcaggccggggcgcgcgtcaccatc
gccgacctgaaccccaacgtgggccagaccgccgccgcgaccctggccgggcagttcgag
gtgctgaacgtcaccgacgccgccgccgtcgccgccctggcccgcaggcttccggacgtg
gacatcctcgtgaacaacgccgggatcgtccgcaacacccccgccgaggccaccccggac
gacgactggcgcagcgtgatcgacgtgaatctgaacggcgtgtactggtgctgccgggaa
ttcggccgggccatgctggagcgcggccagggcagcatcgtgtccaccgccagcatgagc
ggcctgatcagcaaccacccgcagccgcaggcggcgtacaacgccagcaaggccgccgtg
atccacctcacccgctccctggcgggcgagtgggcgccgcgcggcgtgcgcgtgaactgc
gtcgcgcccggctacaccgccacgcccctcaccagacgcggcctggagacccccgaatgg
cgcgagacgtggctgaaggaaaccccgatgggccgcctcgcggaacccgccgagatcgcc
ccggccgtactgtacctcgcctccgaagctgcgagtttcgtcaccgggcacgcgctggtc
gtcgacggcggctacacctgctggtaa

DBGET integrated database retrieval system