KEGG   Deinococcus actinosclerus: AUC44_06670Help
Entry
AUC44_06670       CDS       T04259                                 

Definition
(GenBank) MBL fold metallo-hydrolase
  KO
K06167  phosphoribosyl 1,2-cyclic phosphate phosphodiesterase [EC:3.1.4.55]
Organism
dab  Deinococcus actinosclerus
Pathway
dab00440  Phosphonate and phosphinate metabolism
dab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AUC44_06670
Enzymes [BR:dab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.55  phosphoribosyl 1,2-cyclic phosphate phosphodiesterase
     AUC44_06670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B
Motif
Other DBs
NCBI-ProteinID: ALW88618
UniProt: A0A0U4BYH8
LinkDB All DBs
Position
1370752..1371579
Genome map
AA seq 275 aa AA seqDB search
MTLPLPALTFLGTGDSKGVPRFWCACSVCQEARAGGVNRRGRTATLLRVPRPGGGEGTAL
LDAGPDTHAALARLPGPLVPDVVLITHAHNDHILGLGDLLDYVRYAGGRLRIYAPSEVVP
ALADRFSYAFRAQAPVQPMPDAGVPVGDVTLRLLRVPHGANGHSHAVRLDAPDWRAAVIT
DAIDVPTETAQAWLTGLDLLALGTSFEDEGDVPHSGRSVYDVREALALPWARSARQVILT
HLSHGVDVRRTHLLPPGWSFAHDGLRLPLAGPARV
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgcccctgcctgccctgacgttcctgggcaccggcgacagcaagggcgtgccg
cgcttctggtgcgcctgctccgtgtgccaggaggcccgcgcgggcggcgtgaaccgccgg
ggccgcaccgccacgctgctgcgcgtaccccggcccggcggcggtgagggcaccgcgctg
ctcgacgccgggccggacacgcacgccgcgctggcgcgcctgccgggcccactcgtgccg
gacgtggtgctcatcacgcacgcgcacaacgaccacatcctgggcctgggcgacctgctc
gactacgtgcgctacgcgggcggcaggttgcggatctacgctccatccgaggtggtaccc
gccctggccgaccgcttctcgtatgccttccgcgcccaggccccggtgcagcccatgccc
gacgcgggtgtaccggtgggggacgtgaccctgcgcctcttgcgcgtgccgcacggcgcg
aacggccacagccacgcggtccgcctggacgccccggactggcgggccgccgtgatcacc
gacgccatcgacgtccccacagagaccgcgcaggcgtggctgacggggctggacctcctg
gcgctgggcacctccttcgaggacgagggtgacgtcccgcacagcgggcgcagcgtgtac
gacgtccgcgaggcgctggcgctcccgtgggcgcgctcggcgcggcaggtgattctcacg
cacctgtcgcacggggtggacgtgcgccgcacccacctcctgccgccgggctggtcgttc
gcgcacgatggattgcggctgcccctcgcgggccccgcgcgagtgtga

DBGET integrated database retrieval system