KEGG   Deinococcus actinosclerus: AUC44_11925Help
Entry
AUC44_11925       CDS       T04259                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dab  Deinococcus actinosclerus
Pathway
dab00620  Pyruvate metabolism
dab00680  Methane metabolism
dab01100  Metabolic pathways
dab01120  Microbial metabolism in diverse environments
dab01200  Carbon metabolism
Module
dab_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AUC44_11925
  09102 Energy metabolism
   00680 Methane metabolism
    AUC44_11925
Enzymes [BR:dab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AUC44_11925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF438 PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALW90442
UniProt: A0A0U4C4C0
LinkDB All DBs
Position
2467077..2469572
Genome map
AA seq 831 aa AA seqDB search
MSIRSDVNLLGRTLGQVLKEQEGEAFFELVERTRALVREVRAGGSDAELRAMLAGLSGPD
AGNLARAFTWYFQLVNLAEEYERVRVLAAAGGVRPQSLAQAMQELRAQGLTAEEVEALLA
RLDLGLTFTAHPTEMRRRTVRRHLEQVARAIPTLSDGGVDGPEAAGIAAHVEALWRTPEL
RRLKPTVLDEVKGGLTYVSSIAQALPALQRDLHAAFREVFGRDTAATLPLSFSSWMGGDR
DGNPFVTPQATRETLALHGERAREVLLGLIRQAFADLSQEDEGEEAYREELQSLFDAVKG
GQTLDLVGRLEALHERLLADGQRRTAEQLLSPLLTVARVFGQHLVSLDVREHSAQTGAAV
AELLRAAGVEADYAALPEHAKQELLIRELRSRRPLWPAGEGLPDTLETAVGPIREVRDAV
RRAGPRAFGRYVISMAESVSDVLEPLILAREVGLRILPVPLFETLDDLQRAPQVVWELLS
LPEYRAVLGDDVQEIMLGYSDSNKDTGFLAANWALHEAQRQISDVCRRAGVRWRFFHGRG
TSIGRGGGPASRAILGQPAGTIDAGLRITEQGEALADKYSHPVLARRNLEQALYGLLLSA
ARPAGELNPAWTDAMTRAAASSARAYRALVDDPAFLPFFEHVTPIHEIARLNIASRPVRR
PGAPTLGNLRAIPWVMSWTQNRANLPGWYGLCEGLQEIGVETAREMYATWPFFRTVLDNA
QMSLAKSDPLIFDEYLRLLPEGDAHPLATHLKDAYARTVALVQDVVGAELMANEPRLKES
ISLRNPYIDPIHRIQVELLRRSRGKDGGLDEFERPLLLSIQGIAAGVRNTG
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcggagtgatgtgaacctgctgggccgcacgctggggcaggtgctgaaggaa
caggaaggcgaggcgttcttcgagctggtggagcgcacgcgcgccctggtgcgcgaggtg
cgggcagggggcagtgacgcggagttgcgcgcgatgctggcggggctgtccgggccggac
gcggggaacctggcgcgggcgttcacgtggtacttccagctggtgaacctggccgaggag
tacgagcgggtgcgggtgctggcggcggcgggcggggtgcggccgcagagtctggcgcag
gcgatgcaggaactccgcgcgcagggcctcacggccgaggaggtcgaggcgctgctggcg
cggctggacctgggcctgacgttcacggcgcacccgaccgagatgcgaaggcgcacggtg
cgccgtcacctggagcaggtggcgcgcgccattcccaccctcagtgacgggggcgtggac
gggccggaggcggcggggatcgccgcgcacgtggaggcgctgtggcgcacgccagaactg
cgccgcctgaaacccaccgtgctggacgaggtgaagggcggcctgacgtacgtgtcgagc
atcgcgcaggccctcccggccttgcagcgggacctgcacgcggcgttccgggaggtgttc
gggcgggatacggcggcgacgctgccgctgagcttctcgtcgtggatgggcggggaccgg
gacgggaatccgttcgtgacgccgcaggcgacgcgggagacgctggcgctgcacggcgag
cgggcgcgcgaggtgctgctggggctgatccggcaggcgttcgcggacctcagccaggag
gacgagggcgaggaggcgtaccgcgaggagctccagagcctgttcgatgcggtcaaaggc
gggcagacgctggatctggtgggccgcctggaggccctgcatgagcgtctgctcgccgac
gggcagcggcgcacggcagagcagctgctgtcgccgctgctgacggtcgcgcgggtgttc
gggcagcacctcgtgagcctggacgtgcgcgagcacagcgcgcagacgggcgcggcggtc
gcggagctgctgcgcgccgcgggcgtggaggccgattacgccgcgctgcccgagcatgcc
aagcaggaactgctgatccgggagctgcgctcgcgccgtccgctgtggcctgccggggag
gggctgcccgacaccctggagacggcggtcggcccgatccgcgaggtgcgggacgcggtg
cgccgcgccgggccgcgcgcgttcgggcggtacgtgatcagcatggccgagtcggtcagc
gacgtgctcgaaccgctgatcctggcgcgagaggtgggcctgcggatcctgccggtcccg
ctgttcgagacgctggacgacctccagcgcgcgccgcaggtcgtgtgggaactgctctcg
ctgcccgagtaccgcgcggtgctgggtgacgacgtgcaggagatcatgctgggctacagc
gacagcaacaaggacaccggcttcctcgcggcgaactgggcgctgcacgaggcgcagcgg
cagatcagtgacgtgtgccgccgcgccggggtgcgctggcgcttcttccacgggcgcggc
accagcatcggccgggggggcggcccggccagccgcgccatcctcgggcagcctgccggc
accatcgacgcggggctgcgcatcaccgagcagggcgaggcgctggccgacaagtacagc
cacccggtcctggcgcggcgcaacctggaacaggcgctgtacgggctgctgctgtccgcc
gcgcgcccggccggagagctgaatcccgcctggacggacgccatgacccgcgccgccgcg
agcagcgcccgcgcgtaccgcgcgctggtggacgacccggcgttcctgccgttcttcgag
cacgtcacgcccatccacgagatcgcccgcctgaacatcgcctcccgtccggtgcgccgc
cccggcgcgcccacgctgggcaacctgcgcgccattccgtgggtgatgagctggacgcag
aaccgcgccaacctccccggctggtacgggctctgcgagggcctgcaggagatcggcgtg
gagaccgcccgcgagatgtacgccacatggccgttcttccgcaccgtgctcgacaacgcg
cagatgagcctcgccaagagcgacccgctgatcttcgacgagtacctgcgcctgctgccc
gaaggggacgcgcacccgctcgccacgcacctcaaggacgcctacgcccgcacggtcgcg
ctggtgcaggacgtggtgggcgccgaactcatggcgaacgagccgcgcctgaaagagagc
atcagtctgcgcaacccttacatcgacccgattcaccgcatccaggtggaactcctgcgc
cgcagccgcggcaaggacggcggcctggacgagttcgagcgtcccctgctcctgagcatc
cagggcatcgcggcgggcgtgcgcaacaccggctga

DBGET integrated database retrieval system