KEGG   Delftia acidovorans: Daci_0351Help
Entry
Daci_0351         CDS       T00620                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dac  Delftia acidovorans
Pathway
dac00970  Aminoacyl-tRNA biosynthesis
dac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dac00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Daci_0351
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dac03029]
    Daci_0351
Enzymes [BR:dac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Daci_0351
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Daci_0351
Mitochondrial biogenesis [BR:dac03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Daci_0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF956
Motif
Other DBs
NCBI-ProteinID: ABX32997
UniProt: A9BPM8
LinkDB All DBs
Position
complement(391461..392906)
Genome map
AA seq 481 aa AA seqDB search
MTAKLIQGYEVVIGFETHAQLATQSKIFSRASTAFGAEPNTQACAVDMALPGTLPVMNKK
AVECAIRLGLALGSHIAPRSIFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFFLGDEKK
TIRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEPDIRSTEEAVAYAKTLHQ
IVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREIKNLNSFKNMQLAIDYEIRWQIE
EIEDGRRIQQATVLFDPDTGETRSMRTKEDAADYRYFPDPDLPPLVVAPEWVEQVRADMP
ELPRAMAARFVEQYALPEYDATTLTQSQAMAAYFEDTARACNAPKLASNWIMGEISRRLN
TEEIGMEAAKVSSAQLAALIQRIGDGTISNNAAKQVFEALWSGEGSDVDAIIEAKGLKQM
NDTGAMEKIIDEVIAANPANVEQYRAGKDKAFNALVGQVMKASKGKANPAQVNELLKAKL
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaaactcatccagggctatgaagtcgtcatcggcttcgagacccacgcccag
ctggccacccagtccaagatcttcagccgcgccagcaccgccttcggcgccgagcccaac
acccaggcctgcgccgtggacatggcactgcccggcacgctgccggtgatgaacaaaaag
gccgtcgagtgcgccatccggctcggcctggcgctgggctcgcacattgcgccgcgcagc
atcttcgcgcgcaagaactacttctaccccgacctgcccaagggctaccagatctcgcag
ttcgagattcccgtggtccagggcggcgaagtgtccttcttcctcggcgacgagaagaag
accatccgcctggtgcgcgcccacctggaggaagacgccggcaagtcgctgcacgaggac
ttcatcggccagtcgggcatcgatctgaaccgcgccggcacgccgctgctggagatcgtg
accgagcccgacatccgcagcacggaagaagccgtggcatacgccaagacgctgcaccag
atcgtgacctggatcggcatctgcgacggcaacatgcaggaaggcagctttcgctgcgac
gccaacgtctccgtgcgcaagcccggccagccgctgggcacgcgccgcgagatcaagaac
ctgaacagcttcaagaacatgcagctggccatcgactacgagatccgctggcagatcgag
gaaatcgaggacggccgccgcatccagcaggccaccgtgctgttcgaccccgacacgggc
gagacgcgctccatgcgcaccaaggaagacgcggccgactaccgctacttccccgacccg
gacctgccgccgctggtggtcgcgcccgagtgggtggaacaggtcagggccgacatgccc
gagctgccgcgcgccatggccgcgcgctttgtcgagcagtacgccctgcccgagtacgac
gccaccacgctgacgcaaagccaggccatggccgcctacttcgaggacacggcccgggcc
tgcaatgcgcccaagctggccagcaactggatcatgggcgagatctcgcgccgcctgaac
accgaggaaatcggcatggaggccgccaaggtctccagcgcccagctggccgcgctgatc
cagcgcatcggcgacggcaccatctccaacaacgccgccaagcaggtgttcgaggcgctg
tggagcggtgaaggcagcgatgtcgatgccatcatcgaggccaagggcctcaagcagatg
aacgacacgggcgccatggagaagatcatcgacgaggtgatcgccgccaacccggccaac
gtggagcagtaccgcgcaggcaaggacaaggccttcaacgccctggtcggccaggtcatg
aaggcttccaagggcaaggccaacccggcgcaggtcaacgagctgctcaaggccaagctg
gcctga

DBGET integrated database retrieval system