KEGG   Delftia acidovorans: Daci_0503Help
Entry
Daci_0503         CDS       T00620                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dac03012]
    Daci_0503
   03029 Mitochondrial biogenesis [BR:dac03029]
    Daci_0503
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dac04147]
    Daci_0503
Translation factors [BR:dac03012]
 Eukaryotic Type
  Elongation factors
   Daci_0503
 Prokaryotic Type
   Daci_0503
Mitochondrial biogenesis [BR:dac03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Daci_0503
Exosome [BR:dac04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Daci_0503
  Exosomal proteins of breast cancer cells
   Daci_0503
  Exosomal proteins of colorectal cancer cells
   Daci_0503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ABX33149
UniProt: A9BR91
LinkDB All DBs
Position
534475..535665
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETAGRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLAKYDFPGDDTPIIRGSAKLALE
GDQSDKGEAAILRLAEALDSYIPTPERAVDGAFAMPVEDVFSISGRGTVVTGRIERGIIK
VGEEIEIVGIRDTQKTIVTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPADKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaaaattcgagcgtaccaagccgcacgtcaacgttggcaccatcggtcac
gtggaccacggcaagacgaccctgacggctgctatcgctaccgttctgtccaagaagttc
ggcggcgaagccaaggcttacgaccagatcgacgcagcacctgaagaaaaggctcgcggc
atcacgatcaacaccgcccacgtcgagtacgaaacggccggtcgccactacgctcacgtt
gactgccccggccacgccgactacgtcaagaacatgatcaccggcgctgctcaaatggac
ggcgccatcctggtgtgctcggccgctgacggccccatgccccagacccgcgagcacatc
ctgctggcccgtcaggtgggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgaagagctgctggaactggtcgaaatggaagtgcgcgagctgcttgccaag
tacgacttccccggcgacgacacccccatcatccgcggctcggccaagctggccctggaa
ggcgaccagtccgacaagggcgaagctgccatcctgcgcctggctgaagcactggactcc
tacatccccacgcccgagcgcgctgtggacggtgccttcgccatgcccgtggaagacgtg
ttctcgatctctggccgtggcaccgtggtgactggccgtatcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggtatccgcgacacccagaagaccatcgtcaccggc
gtggaaatgttccgcaagctgctggaccaaggtcaagctggcgacaacgtgggtctgctg
ctgcgcggcaccaagcgtgaagacgtggaacgcggccaagtgctgtgcaagcccggctcc
atcaagccccacacccacttcacggctgaggtgtacgtgctgtccaaggacgaaggtggt
cgccacactccgttcttcaacaactaccgtccccagttctatttccgcacgaccgacgtg
accggctccatcgagctgcccgccgacaaggaaatggtgatgcctggcgacaacgtgtcg
atcaccgtcaagctgatcgcccccatcgccatggaagaaggtctgcgcttcgctatccgc
gaaggtggccgtaccgtgggcgctggcgtggttgccaagatcattgcctaa

DBGET integrated database retrieval system