KEGG   Delftia acidovorans: Daci_0977Help
Entry
Daci_0977         CDS       T00620                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
dac  Delftia acidovorans
Pathway
dac00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Daci_0977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dac01002]
    Daci_0977
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dac01011]
    Daci_0977
Enzymes [BR:dac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Daci_0977
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Daci_0977
Peptidases [BR:dac01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Daci_0977
Peptidoglycan biosynthesis and degradation proteins [BR:dac01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Daci_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ABX33623
UniProt: A9BRQ6
LinkDB All DBs
Position
1087249..1088661
Genome map
AA seq 470 aa AA seqDB search
MASAQADAPTSPASLSTKTARESRLPPAVEAALARAKLPRDAVSALVVEVDGRAAPRLDW
QSHVAMNPASVMKLVTTYAALDQLGPAHVWRTPVFLGGPVQDGVLRGPLYIQGQGDPKLV
MERLWLMLRRLQGMGIKVIVGDIVLDRSAFSVSGHDAATFDNEPWRPYNVAPDALLVNYK
AVTVGFTPDAAAGVARLQYDPPLAGIQQQETVPLAPAGSECGDWRARLQLDMTDPLRIAF
AGPFPASCGDKSWSLAPAQPEAFAARAIEGMWRELGGKLTGTVHDGRVPAGLQPAFQSES
PSLAEVVRDINKYSNNVMAQQVFLTMGMQRTGVASFESSRQALGQWWQARWGAAEQPVAD
NGAGLSREARITASGLGRLLQQAWASPVMPEFVASMPIVGVDGTLRRSLSRAQGMAHLKT
GTLRDASALAGYVDGASGRRYVLVAMANHANAPAARAAWDALVDWTARDR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagcgcccaggcagatgcgcccacctcgccggcctcgctgtccaccaagactgca
cgcgaaagccggctgcccccggccgtggaggcggcgcttgcgcgcgccaagctgccgcgc
gacgcggtctcggccctggtggtcgaggtcgatggccgagccgccccgcgcctggactgg
caaagccacgtggccatgaaccccgcctcggtcatgaagctggtcaccacctatgcggcg
ctggaccagctgggtcccgcacatgtctggcgcacgcccgtcttcctgggcgggccggtg
caggacggcgtgctgcgcgggccgctgtacatccagggccagggcgatcccaaactcgtg
atggagcgactgtggctgatgctgcgccgcctgcagggcatgggcatcaaggtcatcgtg
ggcgacatcgtgctggaccgcagcgcgttttccgtgagcggccatgacgcggccaccttc
gacaacgaaccctggcgcccctacaacgtggcgcccgacgcgctgctggtcaactacaag
gccgtgaccgtgggcttcacgcccgacgcggcggcgggcgtggcgcggctgcaatacgat
ccgccgctggccggcatccagcagcaggaaaccgtgccgctggcgccggccggcagcgaa
tgcggcgactggcgcgcccgtctgcagctggacatgaccgacccgctgcgcatcgccttt
gccggcccgttcccggccagctgcggcgacaagagctggtcgctggcgccggcccagccc
gaggccttcgcggcccgcgccatcgagggcatgtggcgcgagctgggcggcaagctcacc
ggcaccgtgcacgacggccgcgtgccggccgggctgcagccagcgttccagagcgaatcg
ccctcgctggccgaggtggtgcgcgacatcaacaagtacagcaacaacgtcatggcccag
caggtgttcctgaccatgggcatgcagcgcacgggcgtggccagcttcgagtcctcgcgc
caggccctgggccagtggtggcaggcgcgctggggcgcggccgagcagcccgtggccgac
aacggcgccggcctgagccgcgaggcgcgcatcaccgcctcgggtctgggccgcttgctg
cagcaggcctgggcctcgccggtgatgccggagttcgtggcctccatgcccatcgtcggc
gtggatggcacgctgcgccgcagcctcagccgggcccagggcatggcgcatctgaagacc
ggcacgctgcgcgatgcttcggccctggccggctatgtggacggggccagcggccgccgc
tacgtgctggtggccatggccaaccacgccaacgccccggccgcgcgcgcggcctgggat
gcgctggtggactggacggcgcgcgaccgctga

DBGET integrated database retrieval system