KEGG   Delftia acidovorans: Daci_1031Help
Entry
Daci_1031         CDS       T00620                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dac  Delftia acidovorans
Pathway
dac00564  Glycerophospholipid metabolism
dac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Daci_1031
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Daci_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 HI0933_like GIDA Lycopene_cycl NAD_binding_8 Thi4 3HCDH_N Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABX33677
UniProt: A9BRW0
LinkDB All DBs
Position
1148029..1149618
Genome map
AA seq 529 aa AA seqDB search
MSLAASPLPTGRAALLERLAQPETYDLAIIGGGATGLGVALDAAARGFKVVLVESHDFAK
GTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLAFVMPSYKLLDTPF
YGIGLKMYDALAGKAGLGATEFLSRSSTVKCLPTVRQQGLKGGVKYWDGQFDDARLALAL
ARTAAAKGALLVNYCPALELLHEGGKVAGLVCEDTESGRRFTLRAKCVVNATGPWVDLFR
QQDAEAQGRPVKPMVAPSQGVHVVVDRDFLPSDHALLVPKTADGRVLFAVPWLGKVILGT
TDTPRNDLAREPLPFPEELDFILTEAGRYLTRQPTLADVRSMWVGLRPLVKPQDDDGENT
KKISREHTVMSSRTGLVTVTGGKWTTYRAMAEDVLSECFAIGRLPHRPGGVTARLPLAGA
PAESAVHHRMNQVQGLHSYGTEASAVEALPGNDEWLADGLNEAMVRFAARFEYARTVEDV
LARRSRLLFLDARKAAEVAPRVAAILQEELGQDAGLADFMPLAAQYLPA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgctgcttcccctctgcccaccggccgcgccgccctgctggaacgcctggcc
cagcctgaaacctacgatctggccatcatcggcggcggtgccaccggtctgggcgtggcc
ctggacgcggcggcgcgcgggttcaaggtcgtgctggtggagtcgcatgacttcgccaag
ggcacgtcctcgcgtgcaaccaagctggtccatggtggcgtgcgttacctggcccagggc
aacatcgccctggtgcgcgaagcgctgcacgagcgcaccacgctgctgcacaacgcgccc
catctggcgcagccgctggcctttgtcatgccgtcctacaagttgctggacacgccgttc
tacggtatcggcctcaagatgtatgacgcgctggccggcaaggcaggcctgggcgccacg
gaattcctctcgcgctccagcaccgtcaagtgtttgcccaccgtgcgtcagcaaggcctc
aagggcggcgtcaaatactgggacggccagttcgacgatgcccgcctggcgctggcgctg
gcccgtacggccgctgccaagggcgcgctgctggtcaactactgccccgcgcttgaactg
ctgcacgaaggcggcaaggtcgccggcctggtctgcgaagacacggaatcgggccggcgc
ttcacgctgcgcgccaagtgcgtggtcaacgccaccggcccctgggtggacctgttccgc
cagcaggacgccgaggcccagggccgtcccgtcaagcccatggtcgcgcccagccagggc
gtgcacgtggtggtggaccgcgacttcctgcccagcgaccacgccctgctcgtgcccaag
acggccgatggccgcgtgctctttgccgtgccctggctgggcaaggtcatcctgggcacc
accgacaccccgcgcaacgacctggcacgcgagcccctgccgttccccgaggagctggac
ttcatcctcaccgaggccggacgctacctcacgcgccagcccacgctggccgacgtgcgc
agcatgtgggtcggcctgcgcccgctggtcaagccccaggacgacgacggcgaaaacacc
aagaagatcagtcgcgagcacacggtcatgtccagccgcaccggcctggtcaccgtcacg
ggcggcaaatggaccacctaccgcgccatggccgaagacgtgctctccgagtgctttgcc
atcggccgcctgccacaccgcccgggtggcgtcacggcccgcctgccgctggccggcgcc
ccggccgaatccgccgtgcaccaccgcatgaaccaggtccagggcctgcattcctatggc
acggaagcctcggcggtggaggcgttgccgggcaacgacgaatggctggcagacggcctg
aacgaagccatggtgcgttttgccgcgcgcttcgaatacgcgcgcaccgtggaagacgtg
ctggcgcgccgcagccgcctgctgttcctcgatgcgcgcaaggccgccgaggtggcgccg
cgcgtggcagccatccttcaggaggagctggggcaggacgccggcctggcggacttcatg
ccgctggcggcccagtacctgccggcctga

DBGET integrated database retrieval system