KEGG   Delftia acidovorans: Daci_1472Help
Entry
Daci_1472         CDS       T00620                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dac  Delftia acidovorans
Pathway
dac00473  D-Alanine metabolism
dac00550  Peptidoglycan biosynthesis
dac01100  Metabolic pathways
dac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Daci_1472
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Daci_1472
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Daci_1472
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dac01011]
    Daci_1472
Enzymes [BR:dac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Daci_1472
Peptidoglycan biosynthesis and degradation proteins [BR:dac01011]
 Precursor biosynthesis
  Amino acid ligase
   Daci_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 RimK TTL GARS_A ATPgrasp_ST CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABX34116
UniProt: A9BUK8
LinkDB All DBs
Position
1649383..1650363
Genome map
AA seq 326 aa AA seqDB search
MSGFGTQIDVKALGKVAVLLGGRSAEREVSLMSGTGVLKALLSHGVDAHAFDPAERDLGE
LKKEGFDRCFIALHGRYGEDGTVQGALELLGIPYTGPGVMASSIAMDKIMTKRIWRFEGL
PTPDWRLVASAGETRAALQALGAPMIVKPSREGSTIGLTKVWTAEECDQAYVLASRYDPE
VLCEEFIEGDETTCPVLGTGEGAHALPVIRIVAPEGNYDYQNKYFTDDTKYHCPSGLPAE
EEAEIRRIVVRAFRTLGCRGWSRADIMIRASDRKPFLLEINTSPGMTGHSLVPMSARAIG
VSYENLCLGILASAALDAAQPEQEHA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcttcggcacccagatcgatgtcaaggccctgggcaaggtggccgtgctgttg
ggcggccgctcggccgagcgcgaggtctcgttgatgtcgggcacgggcgtgctcaaggcc
ctgctgtcgcatggcgtggacgcccatgccttcgaccccgccgagcgcgacctgggcgag
ttgaagaaggaagggttcgaccgctgcttcatcgcgctgcacggccgctacggcgaagac
ggcacggtgcagggcgcgctggagctgctgggcatcccgtacacgggccccggcgtgatg
gcctcgagcatcgccatggacaagatcatgaccaagcgcatctggcgcttcgagggcctg
cccacgccggactggcgtctggtcgccagcgcaggcgagacgcgcgccgcgctgcaggcg
ctgggcgcgcccatgatcgtcaagccctcgcgcgagggctcgaccatcggcctgaccaag
gtctggacggccgaggaatgcgaccaggcctatgtgctggcctcccgctacgaccccgaa
gtgctctgcgaagagttcatcgagggcgacgagaccacctgccccgtgctcggcacgggc
gagggcgcccatgcgctgcccgtgatccgcatcgtcgcccccgaaggcaactacgactac
cagaacaagtacttcaccgacgacaccaagtaccactgccccagcggactgcccgccgag
gaagaggccgagatccggcgcatcgtcgtgcgggccttccgcacgctgggctgccgcggc
tggtcgcgcgccgacatcatgatccgcgccagcgatcgcaagcccttcctgctggagatc
aacacctcgccgggcatgacgggccactcgctggtgcccatgtcggcccgcgccatcggt
gtcagctacgagaacctctgcctgggcatcctggccagcgccgcgctggacgccgcgcaa
ccggagcaggagcacgcatga

DBGET integrated database retrieval system