KEGG   Delftia acidovorans: Daci_2809Help
Entry
Daci_2809         CDS       T00620                                 

Definition
(GenBank) Hydroxypyruvate isomerase
  KO
K22131  2-dehydrotetronate isomerase [EC:5.3.1.35]
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Daci_2809
Enzymes [BR:dac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.35  2-dehydrotetronate isomerase
     Daci_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABX35447
UniProt: A9BVT4
LinkDB All DBs
Position
complement(3084562..3085359)
Genome map
AA seq 265 aa AA seqDB search
MPRFAANLSMLYNDLDFLDRFEAAARDGFQAVEYLFPYDFAPGQLARRLQDHGLQQVLFN
APPGDWNAGERGLACIPGREAEFAQGMERAVAYAQALGCPRIHVMAGLKPAGASDDILRA
TYIANVRHAARLAAPHGIAILLEPINGRDMPGFFLSRQDQAHALLADIAEPNVQVQMDLY
HCQIVEGDLAMKIRQYLPTGRVGHVQIAGVPERHEPDVGEVNYPYLFRLLDQLGYDGWIG
CEYRPARGAAAHATSEGLGWMKEWL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtttcgccgccaacctgtccatgctctacaacgacctggactttcttgaccgc
ttcgaggccgccgcgcgcgacggtttccaggctgtcgaatacctgtttccctacgacttc
gcgcccgggcaactggcccggcgactgcaggaccacggcctgcagcaggtgctgttcaac
gccccgcccggcgactggaacgcgggcgagcgcggcctggcctgcatccccgggcgcgag
gcggaattcgcccagggcatggaacgtgccgtggcctacgcccaggccctgggctgcccg
cgcatccacgtcatggccgggctcaagcccgcaggcgccagcgatgacatcctgcgcgca
acctacatcgccaacgtgcgccatgccgcacggctggccgcgccccacggcatcgccatc
ctgctggagcccatcaacggccgggacatgcccggcttcttcctgagccgccaggaccag
gcccatgcgctgctggccgacattgccgagcccaatgtccaggtccagatggacctctac
cactgccagatcgtcgagggagacctcgccatgaagatccgccagtacctgcccacgggc
cgcgtggggcatgtgcagatcgcaggcgtgcccgaacgccacgaacccgacgtgggcgag
gtcaactacccctacctgttccgcctgctggaccagctgggctacgacggctggataggc
tgcgaataccgccccgcgcgcggcgcggcggcgcacgccaccagcgaggggctggggtgg
atgaaggagtggctgtag

DBGET integrated database retrieval system