KEGG   Delftia acidovorans: Daci_3661Help
Entry
Daci_3661         CDS       T00620                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dac  Delftia acidovorans
Pathway
dac00020  Citrate cycle (TCA cycle)
dac00480  Glutathione metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
dac01210  2-Oxocarboxylic acid metabolism
dac01230  Biosynthesis of amino acids
Module
dac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dac_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Daci_3661
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Daci_3661
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Daci_3661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABX36293
UniProt: A9C031
LinkDB All DBs
Position
4019792..4021054
Genome map
AA seq 420 aa AA seqDB search
MNRFQHIQVPAEGQKITVNADMSLNVPDQPIIPFIEGDGTGVDITPVMIKVVDAAVARAY
GGKRKIQWMEVFAGEKSTRIYGPDVWLPEETMQALREYVVSIKGPLTTPVGGGIRSLNVA
LRQELDLYVCLRPVQYFKGVPSPLKEPEKTNMVIFRENSEDIYAGIEYEARSDNAKKLID
FLVKEMGVKKIRFPETSGIGVKPVSIEGTERLVRKAIQYAIDNDKPSVTLVHKGNIMKFT
EGGFRDWGYALAAREFGAQPIDGGPWLKFKNPRTGRDIVIKDSIADAFLQQILLRPAEYS
VVATLNLNGDYISDALAAQVGGIGIAPGANMSDSVACFEATHGTAPKYAGKDYVNPGSEI
LSAEMMLRHMGWREAADLVISALEKAIQSKQVTYDFARLMDGATQVSCSGFGEVMISKMD
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttccagcacatccaggtgccggccgagggccagaagatcactgtcaacgcc
gacatgtcgttgaacgtgccagaccagcccatcattcctttcattgaaggcgacggcacc
ggcgtggacatcacgccagtgatgatcaaggtggtggatgccgccgtggccagggcctat
ggcggcaagcgcaagatccagtggatggaggtcttcgcgggcgagaaatccacgcgcatc
tacggccccgatgtctggctgcccgaggaaaccatgcaggccctgcgcgagtacgtggtc
tccatcaagggcccgctgaccacgcccgtgggcggcggcatccgctcgctgaacgtggcg
ctgcgccaggagctggacctctacgtctgcctgcgccccgtgcagtacttcaagggcgtg
ccctcgccgctgaaggagcccgagaagaccaacatggtcatctttcgcgagaactccgag
gacatctacgcgggcatcgagtacgaggcccgcagcgacaacgccaagaagctcatcgac
ttcctggtcaaggaaatgggcgtcaagaagatccgcttccccgagacctcgggcatcggc
gtcaagcccgtgtccatcgagggcacggagcgcctggtgcgcaaggccatccagtacgcg
atcgacaatgacaagcccagcgtgaccctggtccacaagggcaacatcatgaagttcacc
gaagggggcttccgcgactggggctacgcgctggccgcgcgcgagttcggcgcccagccc
atcgacggcggaccctggctcaagttcaagaacccgcgcacgggccgcgacatcgtcatc
aaggactccattgccgacgccttcctgcagcagatcctgctgcgcccggccgagtattcg
gtggtggccacgctcaacctcaacggcgactacatctcggacgcgctggcggcccaggtc
ggcggcatcggcattgcgcccggcgccaacatgtccgactccgtggcctgcttcgaggcc
acgcacggcacggcccccaagtacgctggcaaggactatgtgaacccgggctccgaaatc
ctctcggccgagatgatgctgcgccacatgggctggcgcgaggcggccgacctggtcatc
agcgcgctggaaaaggccatccagagcaagcaggtgacctacgacttcgcccgccttatg
gacggcgccacccaggtgtcgtgctccggctttggcgaggtgatgatctccaagatggat
tga

DBGET integrated database retrieval system