KEGG   Delftia acidovorans: Daci_3942Help
Entry
Daci_3942         CDS       T00620                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dac  Delftia acidovorans
Brite
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Daci_3942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABX36573
UniProt: A9BWP6
LinkDB All DBs
Position
4342201..4342839
Genome map
AA seq 212 aa AA seqDB search
MPLNASQSSHAATSQPSTPSTAVKLLMAAGMVLALGACGSQPKPPAAASASTPAAVTTAP
SSRNVAMAQLQPTQGSKVSGSLQFTAQADGSVRVQGSVQGLAPNSEHGFHVHEKGDCSSP
DGLSAGGHFNPTGQAHGRFDSSTHHTGDLPSLRSDAQGMASIDFVSRGLALDQGPNSVVG
RGLIVHKDPDDYTTQPTGNSGARLACAVITRG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgaacgcttcccaatccagccacgccgccacttcgcagccctccaccccgtcc
accgccgtgaagctgttgatggctgccggcatggtgctggccctgggcgcctgtggcagc
cagcccaagcctcctgccgcagcctccgcatcgaccccggcagccgtaacgacagcgccc
tcctcccgcaatgtagccatggcccagctgcagcccacgcaaggcagcaaggtcagcggc
agcctgcagttcacggcacaggccgatggcagcgtgcgcgtgcaaggctcggtgcagggg
ctggcgccgaatagcgagcacggctttcacgtccatgaaaaaggcgattgctccagccct
gacggcctgagcgcgggcggccacttcaacccgaccggccaggcccatggccgcttcgat
tcgtcgacccatcacacgggcgacctgcccagcctgcgatccgatgcgcaaggcatggca
agcatcgacttcgtgtcgcgcggcctggcattggaccagggccccaacagcgtggtgggt
cgtggcctgatcgtgcacaaggacccggacgactacaccacgcaacccaccggcaattcg
ggcgcgcgcctggcctgtgcggtgatcacgcgcggttga

DBGET integrated database retrieval system