KEGG   Delftia acidovorans: Daci_4339Help
Entry
Daci_4339         CDS       T00620                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dac  Delftia acidovorans
Pathway
dac03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Daci_4339
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dac03400]
    Daci_4339
Enzymes [BR:dac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Daci_4339
DNA repair and recombination proteins [BR:dac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Daci_4339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABX36970
UniProt: A9BWY5
LinkDB All DBs
Position
4748560..4751175
Genome map
AA seq 871 aa AA seqDB search
MPATRSKFQASRQARPTNGAAKAATPQASLALYRQKRDFTRTPEPSAEPSSETIAGQPGA
GALQFVIQKHWASHLHYDFRLELDGSMKSWAVPKGPSYDPADKRMAVQVEDHPMAYNRFE
GQIPPGQYGAGKVIIWDCGTWLPEGDAAEGYRKGKLKFELRGHKLQGRWTLVRMRGKDDA
KKPAWLLIKEHDGLERAASEFNVVEDMPDSVAGLPLPTATAPVTTPVATPVTAPMPQSIA
PQLATLVDHAPADAGQWIFESKFDGYRLLARIEDGAVRLFTRNGKDWTTKMPALAHTFAA
LPLQSGWVDGEVLMLDSDSRPDFQALQNAFDGERTDHLVFFAFDLLWHDGQDLRPQPVEQ
RRQQLQALLHKAPSDRLRFSEAFDAPPADLVAAACQLGLEGVIGKRRGSAYASRRSADWI
KLKCGLRQEFVIAGYTDPQGTRTGLGALVLAVHGEDGQLRAAGKVGTGFNRRTLADLRQR
LERLATGTSPLADSRGLGSGVHWVRPTLLAEVSFAQWTEDGQVRHAVFQGLRADKPARSI
VKEEPQHVPSTASSASAAATPGAARTQTRNARAARLPASMTITHPERVIDPSTGITKMDL
ARYYATVAPFMITHLKSRPVAMVRAPDGIEGELFFQKHLDQAPLQGIAALTPELDPGHAP
LMEVSRREGLVAAAQMNTIEWHTWNARKDRIDRPDRMTFDLDPGEGVPWQQVQEAASLLH
VLLQELELPAFLKTSGGKGLHVVVPIKRLLDWDTVKAFSQAVVQHLAHAVPQRFVAKSGP
RNRVGKIFVDYLRNGFGATTACAWTARARPGMGISVPVAWNELDRLTGGAHWTIRSVDQR
LRLGNSPWEHYGTAAVGLGRAMKALGFEAQH
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgccggccacgcgcagcaagttccaggcatcccgccaggcccgccccaccaatggggcg
gccaaggcggcgacaccccaggcctcgctcgcgctgtaccggcaaaagcgcgacttcacg
cgcacaccggaaccttcggcagaaccttccagtgagacgattgcagggcagcccggcgcg
ggcgccctgcaatttgtcattcaaaagcactgggccagccacctgcactacgactttcgg
ctggagctggacggcagcatgaaaagctgggccgtgcccaagggccccagctacgacccg
gccgacaagcgcatggccgtccaggtggaagaccaccccatggcctacaaccgtttcgag
ggccagattccaccgggacagtacggcgcgggcaaggtcatcatctgggactgtggcacc
tggctgcccgagggcgatgcggccgaaggctatcgcaagggcaagctcaagttcgaactg
cgcggccacaagctgcagggccgctggaccctggtgcgcatgcgcggcaaggacgacgcc
aaaaagcccgcctggctgctgatcaaggagcacgacggcctggaacgtgctgccagcgaa
ttcaacgtggtcgaggacatgcccgacagcgtggccggccttcccctgcccaccgctaca
gcgcccgtcaccacgcccgtcgctacgcccgtcaccgcgcccatgccgcagagcatcgcc
ccgcagctggcaaccttggtggaccatgcacctgcagatgccgggcaatggatctttgag
agcaagttcgacggctaccggctgctggcgcgcatcgaggacggcgccgttcgccttttc
acacgcaacggcaaggactggaccaccaaaatgcccgccctggcccacacctttgccgca
ctgcccctgcaatcgggctgggtggatggcgaggtgctgatgctggacagcgacagccgc
cctgacttccaggccctgcaaaacgcctttgacggcgagcgcaccgaccacctggtgttc
ttcgcgtttgacctgctgtggcatgacggccaggacctgcggccccagcccgtggagcag
cgccgccagcagttgcaggccctgctgcacaaggcgccttcggaccgccttcgtttcagc
gaggcctttgacgccccgcccgccgacctggtggccgccgcctgccagctgggcctggag
ggcgtgatcggcaagcggcgcggcagcgcctatgcctcgcggcgcagtgcggactggatc
aagctcaagtgcggcctgcgccaggaattcgtgatcgcgggctacaccgatccccagggc
acgcgcacgggcctgggcgccctggtcctggccgtgcatggcgaggacggccagctgcgc
gcggcaggcaaggtgggcacggggttcaacaggcgcacactggccgacctgcgccagcgc
ctggagcgccttgccaccggcacctcgccgctggcggacagccggggccttggcagcggg
gtgcactgggtgcgccccacgctgctggccgaggtctcgttcgcgcagtggaccgaggac
ggccaggtccgccatgccgtattccagggcctgcgtgcggacaagcctgcgcgcagcatt
gtcaaagaggagccacagcacgtgccatcgaccgcatcttccgccagcgctgcagccacg
cctggcgccgcacgaacgcaaacccgcaatgccagggcggcgcgactgcccgcctcgatg
accatcacccatcccgagcgggtcatcgatccctccaccggcatcaccaagatggatctg
gcgcgctactacgccacggtggcgcccttcatgatcacccacctcaagtcccggcccgtg
gccatggtgcgggcgccggacggcatcgagggcgagctgttcttccaaaagcacctcgac
caggcgccgctgcagggcatcgccgccctgacgccggaactggaccccggccatgccccg
ctgatggaggtgtcccggcgcgaaggcctggtggcggcggcgcagatgaacaccatcgaa
tggcacacctggaacgcgcgcaaggaccgcatcgaccggcccgaccgcatgaccttcgac
ctggacccgggcgaaggcgtcccctggcagcaggtgcaggaggccgccagcctgctgcat
gtgctgctgcaggagctggagctgccggccttcctcaagaccagcggcggcaagggcctg
cacgtggtcgtgcccatcaagcggctgctggactgggacaccgtcaaggccttctcgcag
gccgtggtccagcacctggcccatgccgtgccccagcgcttcgtggccaaaagcgggccg
cgcaaccgcgtgggaaagatttttgtggactacctgcgcaacggcttcggcgccaccacg
gcctgcgcgtggacggcccgggcgcggccgggcatgggcatctccgtgcccgtggcctgg
aacgagctggacaggctcacgggcggcgcgcactggaccattcgctcggtagaccagcgc
ctgcgcctgggcaactccccctgggagcactacggcacggccgccgtgggcctgggccgc
gccatgaaggcgctgggcttcgaggcgcagcactga

DBGET integrated database retrieval system