KEGG   Delftia acidovorans: Daci_4837Help
Entry
Daci_4837         CDS       T00620                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dac  Delftia acidovorans
Pathway
dac00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Daci_4837
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_4837
Enzymes [BR:dac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Daci_4837
Transporters [BR:dac02000]
 Other Transporters
  Pores ion channels [TC:1]
   Daci_4837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 DUF1231
Motif
Other DBs
NCBI-ProteinID: ABX37466
UniProt: A9BMC1
LinkDB All DBs
Position
5342666..5343286
Genome map
AA seq 206 aa AA seqDB search
MTTLKLYYAPGTCALATRIALIEANAPHEVIKLDFPKGEQRSPEYLAINPKGRVPALVTE
RGVLTETPALLAYVARRFPEARLAPLDDAYAFAHMQDFHSYLSSTVHVAHAHGRRAGRWA
DDEAAIASMQRKVAANMAECFGVIERHYLGDAPWVLGADYSVADAYLFTIAGWLEGDGVD
IAGFPKVQAHFKRMGERAAVRGALGS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctcaagctctactacgcgcccggcacctgcgccctggccacccgcatcgcc
ctgatcgaagccaatgcgccgcacgaagtcatcaagctcgacttccccaagggcgagcag
cgcagccccgaatacctggccatcaatcccaagggccgcgtgcccgccctggtgaccgag
cgcggcgtgctcaccgaaacaccggcactgctggcctacgtcgcgcgccgcttccccgag
gcccggctcgccccgctggacgatgcgtatgcctttgcccatatgcaggatttccacagc
tacctgtcctccaccgtgcacgtggcccacgcccacggccgccgcgcaggccgctgggcc
gatgacgaagcggccattgcctccatgcagcgcaaggtggcagccaacatggccgaatgc
tttggcgtgatcgagcgccattacctgggcgatgcgccctgggtgctgggcgccgactat
tccgtggccgacgcctatctgttcaccattgccggctggctggaaggcgacggagtggac
atcgccggcttccccaaggtgcaggcgcatttcaagcgcatgggcgagcgcgctgccgtg
cgcggggcgctggggagctga

DBGET integrated database retrieval system