KEGG   Delftia acidovorans: Daci_5049Help
Entry
Daci_5049         CDS       T00620                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
dac  Delftia acidovorans
Pathway
dac00250  Alanine, aspartate and glutamate metabolism
dac00410  beta-Alanine metabolism
dac00640  Propanoate metabolism
dac00650  Butanoate metabolism
dac01100  Metabolic pathways
dac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Daci_5049
   00650 Butanoate metabolism
    Daci_5049
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Daci_5049
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Daci_5049
Enzymes [BR:dac01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Daci_5049
Amino acid related enzymes [BR:dac01007]
 Aminotransferase (transaminase)
  Class III
   Daci_5049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 CoA_binding_2 RES
Motif
Other DBs
NCBI-ProteinID: ABX37678
UniProt: A9BMY3
LinkDB All DBs
Position
5593728..5595038
Genome map
AA seq 436 aa AA seqDB search
MSSATASSPNQQLQNRRNAAMPRGVGVMCGFHAVQADNALLTDAEGRQYIDFAAGIAVLN
TGHRHPRVVQAVQQQLERFTHTAFQIVPYESAIALAERINALAPIAGPAKTAFFTTGAEA
VENAVKIARHATGRSAVIAFQGAFHGRTQLGMALTGKVAPYKQGFGPMLGEVFHAPFPGE
QAGVSVQQSLDAIAMLLKTSVDPQRVAAIIVEPVQGEGGFHPVPAALFTGLRQLCDQHGM
LLIADEVQTGFARTGKLFAMEHYGVQPDLITMAKSLGGGLPISGVVGRAAVMDAPHPGGL
GGTYAANPLAVAAAHAVLDVIDEERLCERAHALGNQLRARLQALQAQDAGIADVRGLGSM
LAVEFRLPGSGEPDAQRVAAVVRHAQEQGLLLLTCGLYGNAIRFLYPLTIPQPLFARALD
IIDSAITQSASQPVAA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgccaccgcctcttccccgaaccagcaactccagaaccggcgcaacgccgcc
atgccgcgcggcgtgggcgtgatgtgcggcttccatgccgtgcaggccgacaatgccctg
ctgaccgatgccgagggccggcagtacatcgatttcgcggccggcattgccgtgctcaac
acgggccaccgccatccgcgcgtggtccaggccgtgcagcagcaactggagcgcttcacg
cacacggccttccagatcgttccctacgaaagcgcgattgcgctggccgagcgcatcaat
gcgctggcgcccatcgccggcccggccaagaccgccttcttcaccacgggcgccgaggcc
gtggagaacgccgtcaagatcgcgcgccatgccacgggccgctcggccgtgatcgccttc
cagggcgccttccatggccgcacccagctgggcatggcactgacgggcaaggtggcgccc
tacaagcagggcttcggccccatgctgggcgaagtcttccacgcgcccttccccggcgag
caggcgggcgtgagcgtgcagcagtcgctggacgccattgccatgctgctcaagacctcg
gtggacccgcagcgcgtggccgccatcatcgtggagcccgtccagggcgaagggggcttt
caccccgtgcctgccgccctgttcaccggcctgcgccagctgtgcgaccagcacggcatg
ctgctgatcgccgacgaggtgcagaccggcttcgctcgcacgggcaagctgttcgccatg
gagcactacggcgtgcagcccgacctgatcaccatggccaagagcctgggcggcggcctg
ccgatctcgggcgtggtgggccgcgcggccgtcatggacgcaccccaccccggcggcctg
ggcggcacctatgccgccaacccgctggccgtggccgcggcccatgccgtgctcgacgtg
atcgatgaagaacggctgtgcgagcgcgcccacgcgctgggcaaccagctgcgcgcgcgc
ctgcaagccctgcaggcgcaggatgccggcattgccgacgtgcgcggcctgggctcgatg
ctggccgtggagttccgccttcccggcagcggcgagcccgacgcgcagcgcgtggccgcc
gtcgtccggcacgcgcaggagcagggcctgctgctgctgacctgcggcctgtacggcaac
gccatccgctttctctatccgctgacgattccacagccgctgttcgccagggccctggac
atcatcgacagcgccatcacccagagcgcgtcccagccagtcgccgcctga

DBGET integrated database retrieval system