KEGG   Delftia acidovorans: Daci_5071Help
Entry
Daci_5071         CDS       T00620                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Daci_5071
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Daci_5071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_2 DAO NAD_binding_8 AlaDh_PNT_C FAD_binding_3 Glutaredoxin Thi4 DSBA K_oxygenase Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ABX37700
UniProt: A9BN05
LinkDB All DBs
Position
complement(5619502..5621058)
Genome map
AA seq 518 aa AA seqDB search
MLDNNLKAQLQAYLERLQRPVELVASLDDSQGARELKELLLEIRELSDKITVVEHNDAEV
RKPSFLITNPGVDSGVRFAGVPLGHEFTSLVLALLQVGGHPSKESAELLEQVRNIDVPLH
FETYYSLSCHNCPDVVQALNLMSVLNPKISHTAIDGGLFQKEVEQREVMGVPTVFVNGER
FGQGRMELAEIVAKVDTGAASREAAKISAKDAFDVLIVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTVDIENFISVSKTEGPQLAAAMERHVRDYEVDIMNLQTASKLIPAATEG
GLIEVQTASGASLKAKTVILSTGARWRNMNVPGEDKYRTKGVTYCPHCDGPLFKGKNVAV
IGGGNSGVEAAIDLAGIVRSVTLLEFASELKADAVLQKKLRSLPNVTVILNAQTTEVNGD
GKKVTGLTYKDRTTEEVKTVALEGIFVQIGLLPNTDWLKGTVELTRFGEIVIDAKGHTSV
PGVFGAGDCTNVPYKQIIIAAGAGSTAALSAFDHLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacaacaacctgaaagcccaattgcaggcctacctggagcgcctgcagcgtccg
gtggagctggtggcttcgctggatgacagccagggtgcgcgcgagctgaaggaactgctg
ctggaaatccgcgagctgagcgacaagatcaccgtcgtcgagcacaacgacgccgaggtg
cgcaagccctcgttcctgatcaccaatcccggcgtggacagcggcgtgcgtttcgcaggc
gtccccctgggccatgaattcacctcgctggtgctggccctgctgcaggtcggcggccat
ccgtccaaggaatcggccgagctgctggagcaggtgcgcaatatcgacgtgccgctgcac
ttcgagacctattactcgctgtcctgccacaactgtcccgacgtggtgcaggcgctgaac
ctgatgtccgtgctcaaccccaagatcagccataccgccatcgacggcgggctgttccag
aaggaagtcgagcagcgcgaagtcatgggcgtgcccaccgtctttgtgaacggcgagcgc
ttcggccagggccgcatggagctggccgagatcgtggccaaggtcgataccggcgccgct
tcgcgtgaagcggccaagatttccgccaaggatgccttcgacgtgctgatcgtcggcggc
ggcccggccggcgccgcggctgccatctatgcggcgcgcaagggcatccgcaccggcatc
gccgccgagcgcttcggtggccaggtgctggacaccgtggacatcgagaacttcatctcg
gtctccaagaccgaaggcccgcaactggccgccgccatggagcgccatgtgcgcgactac
gaggtggacatcatgaacctgcagacggcgtccaaactgattccggctgccacggaaggc
gggctgatcgaggtgcagaccgcctcgggcgccagcctcaaggccaagaccgtcatcctc
tcgaccggcgcgcgctggcgcaacatgaacgtgccgggcgaggacaagtaccgcaccaag
ggcgtgacctactgcccgcactgcgacggtcccttgttcaagggcaagaatgtggccgtg
atcggcggcggcaattcgggcgtggaagcggccatcgacctggccggcatcgtgcgcagc
gtgacgctgctggagttcgccagcgagctcaaggccgacgccgtgctgcaaaagaagctg
cgcagcctgcccaacgtcacggtcatcctcaacgcccagaccaccgaggtcaacggcgat
ggcaagaaggtcaccggcctgacctacaaggaccgcacgacggaagaggtcaagaccgtg
gcgctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgactggctcaagggc
acggtggagctgacacgcttcggcgagatcgtgatcgacgccaagggccacaccagcgtg
cccggcgtgttcggcgcaggcgactgcaccaacgtgccgtacaagcagatcatcatcgct
gccggtgccggctccacggctgcgctgtcggccttcgaccacctgatccgccactga

DBGET integrated database retrieval system