KEGG   Desulfofarcimen acetoxidans: Dtox_2148Help
Entry
Dtox_2148         CDS       T00986                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dae  Desulfofarcimen acetoxidans
Pathway
dae00473  D-Alanine metabolism
dae00550  Peptidoglycan biosynthesis
dae01100  Metabolic pathways
dae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dtox_2148
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dtox_2148
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Dtox_2148
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dae01011]
    Dtox_2148
Enzymes [BR:dae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Dtox_2148
Peptidoglycan biosynthesis and degradation proteins [BR:dae01011]
 Precursor biosynthesis
  Amino acid ligase
   Dtox_2148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 RimK ATP-grasp ATPgrasp_ST TTL ATP-grasp_4 GARS_A ATPgrasp_Ter ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ACV62975
UniProt: C8VZ65
LinkDB All DBs
Position
complement(2324179..2325123)
Genome map
AA seq 314 aa AA seqDB search
MIKKIGVLLGGKSAEREVSLRTGEAIYKALLGLGYQVVKIDVQENIAERIKEESIDMAFL
ALHGKYGEDGCIQGLLEILNIPYTGSGVLASALAMDKIATKRMLLQAKLPTAEFSLIRRS
SYNNETKEEICQTLFKYMPLPLVVKAPTQGSTIGISFVNNEEQLPDALEEAFRYDPIALI
EQFISGTEVTATVLGNNQPEALPLIEIVSNTGVYDYKAKYTVGLSDHIMPPRLKEEVQKN
VQELAVKVFKTMGCSGLARVDFIVDANSNPYILEINTIPGMTETSLAPDAARAAGISFTD
LTDRMIKFALEKDD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaattggcgtacttttaggcggaaaatcagcagaacgagaagtatcgctt
aggaccggagaagctatttataaagctctgttaggcttaggttaccaggttgtgaagatt
gatgttcaagagaatattgctgagcgaataaaagaagaaagcatagacatggcttttctg
gctcttcacggtaaatatggagaagacggttgcatacaaggtttgctggaaatactaaat
ataccttatactggttcaggtgttttagccagtgctcttgccatggataaaatagctacc
aaaagaatgctgcttcaggcaaagctgccaacagcagaattctctctaatcaggcgcagc
agttataataatgaaactaaagaagaaatctgtcagaccctattcaagtacatgccttta
cctttggtggtaaaagccccgacacaaggatctaccataggtatttcttttgttaataat
gaggaacaactaccggatgcgttagaggaagctttcagatatgacccaattgctttgata
gagcaatttatctccggtactgaagttaccgcaactgttttaggaaacaaccagcctgaa
gcactacctttaatagagattgtttctaataccggagtatatgattataaggccaaatat
acggttggattaagtgatcacattatgccacccagactaaaggaggaggtgcaaaaaaat
gttcaggagctggcagtaaaggttttcaaaacaatgggctgcagtggtttagccagagta
gattttatcgtagatgcaaactctaatccttatattttagaaataaatacaattcccggc
atgactgaaaccagtcttgctcctgacgcggccagagcagcggggataagttttacagat
ttaactgacagaatgatcaaatttgccctggaaaaagatgattga

DBGET integrated database retrieval system