KEGG   Desulfofarcimen acetoxidans: Dtox_2362Help
Entry
Dtox_2362         CDS       T00986                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dae  Desulfofarcimen acetoxidans
Pathway
dae00500  Starch and sucrose metabolism
dae01100  Metabolic pathways
dae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dtox_2362
Enzymes [BR:dae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Dtox_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ACV63173
UniProt: C8W0B8
LinkDB All DBs
Position
2534917..2537463
Genome map
AA seq 848 aa AA seqDB search
MFFLRTLSVAPKLPENIGELSKLAYNVWFSWNPNAWELFRRIDKKLWEEVGHNPVKFLLN
VKQQDLDNAALDHDYLNLYKKVIQELNAYLEEETKFKNYHPEHKDQVIAYFSAEFGIHES
HPTYSGGLGLLAGDHCKAASDLGLPFVGMGLLYKNGYFEQRINIEGWQESRYSNFNYHQM
PVRTVTNNDGSELIIPVEMPGRTVYLKVWCMHVGRINIYFLDADLSQNAVHDRSLTGQLY
GGDRENRIAQEILLGIGGVKALRAIGINPQAWHINEGHAAFLILERLRELVQAGIPLVTA
MEAVRSNTIFTTHTPVPAGHDVFSSELIDKYLWQLRDQLGLSGEDFLKLGWDDEKYQFNM
TLLALRLSLFCNGVSKLHGQVSREMFQRFYPNIPVEEIPISSVTNGVHVATWLAPKLREL
LDKYLGSGWHNDISLPKKWAGISQIPAQELWNVHYKLKEKMIQTARNNLRGQRLRNQESY
QRIMEVNNFLDPNVLTIGFARRFATYKRANLLLQDKERLIKILSDKAKPVQIVFAGKAHP
ADYPGQELIKEIYSLTNEEAFRGRILFLEDYDINLARTLLHGVDVWLNTPRRPMEASGTS
GQKAALNGVINFSVLDGWWPEAYNGENGFVVGNDVVCKDEAKQDKNDVFTLYSLLEETIV
PMYYDRDHNNIPRAWVELMKRSLLTIPHYFNTERMVMDYCNNFYVPAITRWKRFSADNYE
LAHQLQSFKQRLYDNWHQVSIVSVNTAADRVLKIGEEFKVEAVVELGYLSPNEVSVEVFC
IDLENPGIRNINLIPMSPVNQISENQYTFAGKCIPPQGVVNYSVRVRPSHPDFEHNFEVP
LVTWAQSF
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcttacgcacactgtcagtagctcctaaacttccggaaaatataggtgaactg
agcaagctggcttataatgtttggtttagctggaatcccaatgcctgggagctttttcga
cgaattgataaaaagctctgggaagaggtaggacataaccctgtaaaatttttactaaac
gtgaagcagcaggatttggataatgccgccctagaccacgattatttgaatctctataaa
aaagttattcaggagctaaatgcttacttagaagaagaaactaaatttaaaaactatcac
cctgagcataaggatcaggtaattgcttatttttctgcagaatttggtatacacgaatca
catcctacttattcaggtggcttaggtttgttagccggtgaccattgcaaagcggccagc
gacctgggtttaccctttgtgggcatgggattgctttataaaaacggttattttgagcaa
cgtataaatattgaaggctggcaggaatcaagatattctaattttaactaccaccagatg
cctgttaggacagtaactaataatgacggaagtgaattaatcattcccgtagaaatgccg
ggtagaactgtttaccttaaagtatggtgcatgcatgttgggcgcattaatatctatttt
ttggatgccgatttatcccaaaacgcagtgcatgacagatctcttaccgggcagctttac
gggggagacagagaaaaccgcattgcccaggaaatactgctgggtattggcggtgttaaa
gcacttcgtgccataggtattaatccccaggcctggcatattaatgaagggcatgccgct
tttctaatactggaacgcttgcgtgaacttgtacaagccggtattcccctggtaaccgca
atggaagcagtaagatccaatactatatttacaacacatactccggtacccgccggtcat
gatgttttcagttcggaattaatagataaatacctttggcagctcagggatcaattaggc
ttgagcggggaggattttctcaagctgggctgggatgacgagaaataccagtttaatatg
actcttttggcgttacgcctgtctcttttctgtaatggtgtaagcaagttgcatggtcag
gtttccagagaaatgtttcaacgtttttatcccaatatccctgtggaggaaattcctatt
tcctcggtaactaacggtgtacacgttgctacctggctggcgcccaaactaagagaatta
ctggataagtatttaggctcaggttggcataacgacatttcacttccgaaaaaatgggca
ggtataagccaaattcccgcacaagaactatggaatgttcattacaaattaaaggaaaaa
atgattcaaacagccagaaataatttaaggggccagcgcctgcgcaaccaggagtcctac
caacgaatcatggaggtaaataattttctggatcccaatgttttaactattggctttgct
cgtcgttttgctacatataagcgtgctaatttattattacaggataaagagcgtctgatt
aaaatactatcagacaaagcaaagccggtacaaatcgtttttgcaggcaaggcacaccct
gctgattacccgggtcaagagctaattaaagaaatatactcgctgaccaatgaagaagcg
ttccggggcaggatattatttttggaagactatgatattaatttagctcgcacattactc
cacggtgtggatgtttggcttaataccccacggcgaccgatggaggcgagcggcaccagc
ggtcaaaaggcagctttaaacggcgtgattaatttcagtgttcttgatggctggtggcct
gaagcatacaatggcgaaaacggttttgttgtaggcaacgatgttgtatgcaaagatgag
gccaagcaggacaaaaatgatgttttcactctttattccctgctggaagaaaccattgtt
cctatgtattacgatagggatcataacaatattcccagagcctgggtggagttgatgaag
aggtccctgctgacaattccacactattttaacacggaaagaatggttatggattactgc
aataatttctacgttcccgccattaccaggtggaaacgctttagcgcggataattatgag
ctggctcatcagcttcaatcatttaagcaaagattgtatgacaactggcaccaggtctcg
atagtgtccgtaaataccgctgctgatcgggtgcttaaaatcggtgaagaatttaaggtg
gaagctgttgtggaattgggttacctttcaccaaacgaagtctccgtagaagtattttgc
attgatttagaaaacccgggtataagaaatattaacttgataccaatgtctccggtcaat
cagatttcagagaaccaatatacttttgcgggcaaatgtattccaccccagggcgtggtt
aactactcagttcgtgtaagaccctcacatcctgactttgaacataattttgaagttcct
ctggttacctgggctcaatctttttaa

DBGET integrated database retrieval system