KEGG   Desulfofarcimen acetoxidans: Dtox_2740Help
Entry
Dtox_2740         CDS       T00986                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
Organism
dae  Desulfofarcimen acetoxidans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 3HCDH_N NAD_binding_2 2-Hacid_dh_C HI0933_like GFO_IDH_MocA FAD_binding_3 F420_oxidored NAD_binding_7 ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACV63518
UniProt: C8W1P7
LinkDB All DBs
Position
2894874..2895908
Genome map
AA seq 344 aa AA seqDB search
MMKAAVVYGKDDIRIEMTPKPSAGEGDLVVKVRSCGICATDVKILLGNGLPKDLPTILGH
EVAGEIAEIGQGVDGFTAGQRVAVYPIAVCGECEFCRRDNHNLCLKEFGLSHGIDGGFAE
YVRIPYQIVKAGGVVIIPDHLSFEEAAMAEPLSCCLAAARSGPVGPGCTVAIIGAGPMGL
LHLKVAKQAGAKVIVADLLEQRLNQAKEMGADFTINTSHEDFVQSARQLTGGLGADMVIA
SLGIPQIMQDYLPAVKNGGTFNIFGGPPAGQSMTVDPRWLHYGEIKITGTFASTPQDFQR
AVELIASGEIAVKDMISHRFSLDNLLEAVEKVKNREMIRGVLSI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcagccgtggtatatggaaaagatgatatccgcattgagatgactccaaaa
ccgagcgccggagaaggcgatttggtagtcaaggtacgttcctgcggcatctgcgccact
gatgttaaaattttgctgggcaacgggctgcccaaagacctgcccaccatattaggtcac
gaagtagccggtgagattgccgaaataggtcagggtgtggatggttttacagcagggcaa
agagtcgctgtctaccctatagcagtatgcggcgaatgtgaattttgccggcgcgacaac
cataatctctgcctgaaggagttcggcttatcccacggcattgacgggggttttgccgag
tatgtgagaataccttaccagattgtcaaagcaggtggtgtggtaattattcctgatcat
ctctcctttgaagaagcagctatggctgagcctctctcctgctgcctggccgcagctcgc
agcgggccggttggtccaggctgcaccgtagccattattggagccgggccgatgggactg
cttcatctcaaagtagccaaacaggccggtgctaaagttattgtcgctgatttactggaa
cagagacttaaccaggcaaaagaaatgggagctgattttacaattaacaccagtcatgag
gatttcgtacagtcagccaggcagcttaccggcggacttggcgcggatatggttatagcc
tcgctgggaatccctcaaatcatgcaggattatttgccggcagttaaaaacggcgggact
ttcaatattttcggcggaccaccggcgggacaaagtatgactgtggaccccaggtggctg
cattacggcgaaataaaaattaccggcacctttgcttcaacaccgcaggattttcagcgg
gcagtagagctgattgcttcaggtgaaattgcagtcaaagatatgatctcgcaccgtttc
agcctggataatttattagaggctgtggaaaaggtaaaaaaccgtgaaatgattcgcgga
gttttgagtatataa

DBGET integrated database retrieval system