KEGG   Desulfofarcimen acetoxidans: Dtox_3770Help
Entry
Dtox_3770         CDS       T00986                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
dae  Desulfofarcimen acetoxidans
Pathway
dae00473  D-Alanine metabolism
dae01100  Metabolic pathways
dae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dtox_3770
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Dtox_3770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dae01011]
    Dtox_3770
Enzymes [BR:dae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Dtox_3770
Peptidoglycan biosynthesis and degradation proteins [BR:dae01011]
 Precursor biosynthesis
  Racemase
   Dtox_3770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACV64477
UniProt: C8VX81
LinkDB All DBs
Position
complement(3942782..3943903)
Genome map
AA seq 373 aa AA seqDB search
MYEKTTWAEINLSAIAHNIQELRRIAAPGAQLMAVVKADAYGHGAVETARIALDNGVVIL
AVSRVSEGVALREAGIDCPVLVLGYLSPGEVLFSLKNDLSHTVFNMQQAEILSDIATKAG
IKAKVHIKIETGMGRLGFEACQAVVEQVIAVTRLSHLKVDGIFTHFAVSDIIDKSYTRQQ
LFRFQEVLRELHRKGVDIQLKHAANSAAIIDMPDTHLNMVRAGIAMYGLYPSEGVDKSRI
VLQPAMSFKTQVGHIKRVPAGYPVSYGCTYITRRPTLIATLPVGYADGYSRLLSSRAEVL
IHGQRAPVVGRVCMDQCMIDVGHINDPLIGDEVVLWGQQGESSLPVEEVAEKMGTINYEL
VCMVNVRVPRVYI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagaaaaccacctgggcagaaattaatctttcggcgatagctcataacattcaa
gaattgcggcggatagctgcgcccggagcacagttgatggctgtagtaaaggcggatgct
tacggtcacggagctgtggaaaccgccaggattgctttggataacggtgttgtgatactg
gcagtttcccgtgtttcagagggtgtagcactgcgcgaggccggaattgactgtccggtc
ttagtgctgggctatctgtcccccggggaagtgttgttttcgttaaaaaatgacctgtct
catactgttttcaatatgcagcaggccgagattctttcggacatagccactaaagcaggt
ataaaagcgaaagtacatataaaaattgagaccggtatgggacgattgggctttgaggcc
tgtcaggctgttgttgagcaggttatagctgttaccagactttcacatttaaaagtggat
ggtatttttacacattttgccgtgtctgatattattgataaaagctataccagacagcaa
ttattcaggtttcaagaagtgctgcgggagttacatcgcaaaggggtggatatacagtta
aagcatgcagccaacagcgcggcaattattgatatgccggatacgcatttgaatatggtt
cgcgcgggtatagccatgtacggtttgtacccatctgaaggggttgacaaaagcaggatt
gttttgcagccggccatgtcctttaaaacgcaggtaggacatataaaaagggtgcctgcg
ggctatccggtcagttatggttgtacatatataaccaggcggcctactcttattgccacg
ttgcctgttgggtatgccgacggttacagccgtctcctatcctcgcgggcggaggtgttg
attcacggtcagcgcgcacctgttgtgggcagggtatgtatggatcagtgcatgatcgat
gttggccacataaatgaccctttgatcggggatgaagtggtattgtggggccagcagggt
gagtctagcctgccggttgaagaggtggcggagaaaatgggtactattaactatgaatta
gtttgtatggtgaatgttcgtgtgccaagagtgtatatttaa

DBGET integrated database retrieval system