KEGG   Desulfovibrio africanus: Desaf_0137Help
Entry
Desaf_0137        CDS       T01662                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
daf  Desulfovibrio africanus
Pathway
daf00473  D-Alanine metabolism
daf00550  Peptidoglycan biosynthesis
daf01100  Metabolic pathways
daf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:daf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desaf_0137
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desaf_0137
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Desaf_0137
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:daf01011]
    Desaf_0137
Enzymes [BR:daf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Desaf_0137
Peptidoglycan biosynthesis and degradation proteins [BR:daf01011]
 Precursor biosynthesis
  Amino acid ligase
   Desaf_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 GARS_A ATPgrasp_ST RimK ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: EGJ48497
UniProt: F3YVA5
LinkDB All DBs
Position
147488..148408
Genome map
AA seq 306 aa AA seqDB search
MRVLLIAGGWSNEREVSLSGAAKIHEALLRLGCKVTRLDPAERFDDILELASGSDFAFIN
MHGTPGEDGLVQAMLEQVDCPYQGSGPKASFLALNKACAKQVFARAGIPTPRWEYLPRRP
QAGWSTKLRFPLFVKPNMGGSSLDLCRADNAEELTPAIERIFCRGETVLLEEGVNGQEVT
SAILGEKALPLILIQPAGCAFFDYRCKYTQGGAKEICPAPIPERIARRVQELSMRAHKAM
KLRGYSRSDFMLEGDEPYILEVNTLPGMTPTSLVPQAAHEAGLDFDALIKRLMDLGLEAH
GRKSEI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgcttttgatcgcgggaggctggtccaacgagcgtgaagtctctttgtccggc
gcggcaaagattcatgaagccctgctgcggctgggctgcaaggtcacgcgcctggatccc
gccgaacgcttcgacgacatcctggagcttgcctcgggctctgacttcgccttcatcaac
atgcacggcacgcccggagaagacgggctcgtgcaggccatgctggagcaggtggactgc
ccataccagggctcgggccccaaggcttccttcctggccttgaacaaggcctgcgccaag
caggttttcgcccgcgccggcattcccacgccgcgctgggaatacctgcctcgcaggccc
caggcgggctggagcacgaagctgcgcttcccgctgttcgtcaagccgaacatgggcgga
tcgagtctggacctgtgccgcgcggataatgccgaggagctgaccccggctattgagcgc
attttttgccgaggagaaacggtcctgctggaagagggtgtgaacggccaggaagtcacc
agcgccatcctgggtgagaaagcgttgccgctcattcttatccagcctgccggctgcgcc
tttttcgattaccgctgcaagtacacgcagggcggtgccaaggagatctgtcccgcgccc
atcccggagcggatcgcccgccgcgtgcaggagctgtccatgcgcgcgcacaaagccatg
aagctgcgcgggtatagccgctcggacttcatgctcgaaggcgatgagccctatatcctc
gaagtgaacaccctgccgggcatgactcccacgagcctcgtgccccaggccgcacacgag
gccgggctggacttcgatgcgctcatcaagcggctcatggatctggggctggaggcccat
ggccgcaagtccgagatctag

DBGET integrated database retrieval system