KEGG   Desulfovibrio africanus: Desaf_0159Help
Entry
Desaf_0159        CDS       T01662                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
daf  Desulfovibrio africanus
Pathway
daf00500  Starch and sucrose metabolism
daf01100  Metabolic pathways
daf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:daf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desaf_0159
Enzymes [BR:daf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Desaf_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glyco_transf_5 Glycos_transf_1
Motif
Other DBs
NCBI-ProteinID: EGJ48519
UniProt: F3YVC7
LinkDB All DBs
Position
170827..173400
Genome map
AA seq 857 aa AA seqDB search
MRPLRSFSVVAKLPPNLAPMWELAYNFLFSWNDQIADLFSQIDQRLWRESDGNPVAFLNS
LPQMTLDILAQDRFFLARLNDLLASLRQYVAKDQPTINFPHKAEDKPVVAYFSAEYGLDL
SLPVYSGGLGILAGDHLKSASDLNVPLVAVGLCYQQGYFRQYLTPDGWQQERYPTYDFEQ
LPISPVQDQAGHPVLIEVDLLGEKLRARIWKAQVGRVSLYLLDSNIGDNPPHLRGVTARL
YGGDLEMRLRQEILLGVGGIRALWAMGLEPKVIHMNEGHSAFAGLERIRVFMSQHSLSFE
AAMELVASSSVFTTHTPVPAGNDRFPPELMQRYFDPYARQIGLAWKVFMALGREDPRDDG
EFFCMTVLALRLSRFSNGVSKLHGHVSRNMWKRVWPQYPVEDVPIGAITNGVHMPTWVAY
DMALLYDRYLGPTWKEDPDCDRVFKLADTIPESELWRTHERLRERLIDYVRYRLREQLKR
KGARAKELEAADSVLNPQALTICFARRFATYKRANLLLQDRERLLRILNDSEQPVQMVFA
GKAHPHDNEGKKIIQQIVQLCRMPELRNKLVFIEDYDMILAKHLVQGGDVWLNNPRRPLE
ACGTSGMKAMANGMLNLSVLDGWWDEAYQPDNSVGFAIGKGEEYDDLAYQDFVESQTLYN
VLETEVIPDFYDRAHDSLPRNWIKRMKKALVELGPVFNAHRMVEEYSWRTYAPAYENYKR
LVRDNFQPAKDLAAWRMDLMTKWSQIRIRNVRAAAGDQIHVKQPLVVEAEIFLDGLRPED
IQAEIYAGPLTQDGQFAQRTTTIMRNEGLAQDGWHLYRGQTMPGEAGRFGFTMRILPHHP
LLLDPHSLGLIRWVDAQ
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccacttcgttccttcagcgtggtagccaagctcccgccgaatctcgcccccatg
tgggagctggcctacaacttcctgttctcctggaacgaccagatcgccgatctgttctcc
cagatcgaccagcgcctgtggcgcgagagcgacggcaaccccgtggccttcctgaacagc
ctgccccagatgaccttggacatactggctcaggaccgcttcttccttgcgcggctgaat
gacctgctcgcctccctgcgccagtacgtggccaaggaccagccgaccatcaacttcccg
cataaggccgaggacaagccggtggtggcctatttcagcgccgagtacggcctggacctg
tcgctgcccgtatactccggcggccttggcatcctggccggcgaccacctcaagtccgcc
agcgacctgaacgtccccctggtggccgtgggtctgtgctaccagcagggctatttccgc
caatacctcacgcccgacggctggcagcaggagcgttatccgacttacgacttcgagcag
ttgcccatatccccggttcaggaccaggctggccaccctgtgctcatagaggtggatctg
ctgggcgaaaagctcagggcgcgcatctggaaggcccaggtaggccgcgtttccctgtat
ctgctggattcgaatatcggcgataatccgccgcatctgcgcggcgtcacggcccggctg
tacggcggggacctggagatgcgcctgcgccaggagatcctgctcggcgtcggcggcatc
cgcgccctgtgggccatgggcctggagcccaaggtcatccacatgaacgaggggcactcg
gccttcgccggcctggaacgcatccgggtgttcatgagccagcacagcctgtccttcgag
gcggccatggaacttgtggcctcctcctcggtcttcaccacgcatacgccggtgccagcg
ggcaacgaccgcttcccgcccgagctcatgcagcgctacttcgacccttacgctcgccag
atcggtctggcctggaaggtcttcatggccctgggccgcgaggatccgcgcgacgacggc
gagttcttctgcatgaccgtgctggctttgcggctgtcgcgcttcagcaacggcgtgagc
aagctgcacggtcatgtgtcgcgcaacatgtggaagcgcgtctggccccagtacccggtg
gaggacgtgcccatcggagccatcaccaacggcgtgcacatgcccacctgggtggcctac
gacatggccctgctctacgaccgttatctgggaccgacttggaaggaggacccggactgc
gaccgcgtgttcaagctggccgataccattcccgaatcggagctgtggcgcacccatgaa
cgcctgcgcgagcggcttatcgattacgtgcgctaccgcctgcgcgaacagctcaagcgc
aagggcgcgcgggccaaggaactcgaggccgcggacagcgtgctcaatccccaggccctg
accatatgcttcgcccgccggttcgccacctataagcgcgccaacctgctgttgcaggac
agggagcggctgctgcgcatcctgaacgacagcgagcagcccgtgcagatggtcttcgcc
ggcaaggcccaccctcacgacaacgagggcaagaagatcatccagcagatcgtgcagctc
tgccgcatgccagagctgcgcaacaagctcgtgttcatcgaggactacgacatgatcctg
gccaagcacctggtccagggtggcgacgtgtggctcaacaacccgcgtaggcctctggag
gcctgcggcaccagcggcatgaaggccatggccaacggcatgctcaacctgagcgtgctg
gacggctggtgggacgaggcttaccagccggacaacagcgtgggcttcgccatcggcaag
ggcgaggagtacgacgacctggcctaccaggatttcgtggagagccagactttgtacaat
gtgcttgagaccgaggtcatcccggacttctacgaccgcgcccacgacagcctgccgcgc
aactggatcaagcgcatgaagaaggccctggtggagcttggcccggtgttcaatgcccat
cgtatggtcgaggagtacagctggcgcacgtacgcgccggcctacgagaactacaagcgg
ctggtgcgcgacaatttccagccggccaaggacctggcagcctggcgtatggatctcatg
accaagtggagccagatccgcattcgcaacgtgcgcgccgcggccggggaccagatccac
gtcaagcagccgctggtggtggaggccgagatattcctggacggcctgcggcccgaggac
atccaggccgaaatctacgccggcccgttgacccaggacggccagttcgcccagcgcacc
accacgatcatgcgcaacgaaggccttgcccaggacggctggcatctctaccgaggccag
accatgccgggcgaggccggacgcttcggcttcaccatgcgcatcctgccgcatcatccg
ttgctgctggatccgcattcattggggcttatccgctgggtggacgcacagtag

DBGET integrated database retrieval system