KEGG   Desulfovibrio africanus: Desaf_0230Help
Entry
Desaf_0230        CDS       T01662                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
daf  Desulfovibrio africanus
Brite
KEGG Orthology (KO) [BR:daf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:daf03012]
    Desaf_0230
   03029 Mitochondrial biogenesis [BR:daf03029]
    Desaf_0230
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:daf04147]
    Desaf_0230
Translation factors [BR:daf03012]
 Eukaryotic Type
  Elongation factors
   Desaf_0230
 Prokaryotic Type
   Desaf_0230
Mitochondrial biogenesis [BR:daf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Desaf_0230
Exosome [BR:daf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Desaf_0230
  Exosomal proteins of breast cancer cells
   Desaf_0230
  Exosomal proteins of colorectal cancer cells
   Desaf_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: EGJ48588
UniProt: F3YTY2
LinkDB All DBs
Position
complement(250362..251555)
Genome map
AA seq 397 aa AA seqDB search
MGKAKFERKKPHVNIGTIGHIDHGKTTLTAAITKTLSMKGWAQFTAFDQIDKAPEEKERG
ITIATAHVEYETANRHYAHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVGVPALVVFLNKVDLVDDEELLELVELEVRELLSKYDYPGDDTPVVRGSALQALE
SDDVNSDACKPIFELMKACDEFIPEPQRDIERPFLMPIEDVFSISGRGTVVTGRVERGII
KVGGEVAIIGIKDTVKTTCTGVEMFRKILDQGQAGDNVGVLLRGVKREDVERGQVLAAPN
SITPHKKFNAEVYILSKEEGGRHTPFFSGYRPQFYFRTTDITGVVTLAEGVEMVMPGDNA
TFMVELIAPIAMEKGLRFAIREGGRTVGAGVVSEITE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagcgaaattcgagcggaagaagccgcacgtaaacatcggcaccatcggtcac
atcgaccatggcaagaccacactgacggccgccatcaccaagaccctgtccatgaagggc
tgggcccagttcacggccttcgatcagatcgacaaggcccctgaagagaaagagcgcggc
atcaccatcgccacggcgcacgtggagtacgagaccgccaatcgtcactacgcgcacgtg
gactgcccgggtcacgccgactacatcaagaacatgatcacgggcgcggcccagatggac
ggcgcgatcatcgtcgtggccgccaccgacggccccatgccccagacgcgtgagcacatc
ctgctcgcccgtcaggtcggcgtgccggccctggtggtcttcctgaacaaggtcgacctg
gtggacgacgaggagctgcttgagcttgtcgagctcgaagtgcgcgagcttctgtccaag
tacgactaccccggcgacgacaccccggtggtgcgcggctcggccctgcaggccctggag
tccgacgacgtgaactccgacgcctgcaagccgatcttcgagctcatgaaggcctgcgac
gagttcattcccgagccgcagcgcgacatcgagcgccccttcctgatgcccatcgaggac
gtgttctccatctccggccgcggcaccgtggtcacgggacgcgtggagcgcggcatcatc
aaggttggcggtgaagtggccatcatcggcatcaaggatacggtcaagacgacctgcacg
ggcgttgagatgttccgcaagatcctggaccagggccaggcgggcgacaacgtgggcgtg
ctgctgcgcggcgtcaagcgcgaggacgtggagcgcggccaggtgctggcagccccgaac
tcgatcacgccgcacaagaagttcaatgccgaggtgtacattctgtccaaggaagagggc
ggccgtcatacgccgttcttctccggatatcgtccgcagttctatttccgcaccacggac
atcaccggtgtggtgaccctggccgagggcgtggagatggtcatgcccggcgacaatgcc
acgttcatggtcgagctgatcgcccccatcgccatggagaagggcctgcgcttcgccatc
cgcgagggcggacgcaccgtgggcgccggcgttgtctccgaaatcacggagtaa

DBGET integrated database retrieval system