KEGG   Desulfovibrio africanus: Desaf_0308Help
Entry
Desaf_0308        CDS       T01662                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
daf  Desulfovibrio africanus
Pathway
daf03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:daf00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Desaf_0308
Enzymes [BR:daf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Desaf_0308
DNA repair and recombination proteins [BR:daf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Desaf_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: EGJ48665
UniProt: F3YU59
LinkDB All DBs
Position
complement(331661..334456)
Genome map
AA seq 931 aa AA seqDB search
MARLSEYWRKRDFSRTPEPSGRGPELESGRGFVIHKHKARRLHYDLRLELDGVLLSWAVP
RGPSLDPGQKRLAVRVEDHPVEYGSFEGVIPQGEYGGGTVMLWDRGVWEPEGDPHEGLRQ
GKLHFRLRGEKLSGGWILAHMSGKRAKENDWLLIKVRDEQANQRLDIETDRPESAVTGRT
LAQIASSADRVWSGAGEHASGTDSRRDVRDRERTGAEAEGVTIGTLDGDVRARIAGNVGP
APPAAVEYADTQPLPPPAQGQARPETLTIKNKTAESPRSPGLPDFAAMPGARPGPMPEQI
RPQLATLVDSPPAGEQWLHEIKFDGYRLLLIIDNSKARLMTRGGQDWTHRFPELARAAGG
LTLRRAVLDGEAVVLDERGRPDFQALQNVLKGLSGGTLAMYLFDMPYAEGQDLSGCALIE
RKEALRSVLGAIGQTPSPLRFSDHIVGKGKLVLENACQMGLEGIVSKRADAHYEPRRAPT
WLKSKCGHRQEVVVAGWTDPKGQRTGFGALLVGVHDRQGRLIYAGKVGTGYDTQVLGDLS
GRLAGLATDDAAFADTHRVGSLADVHWVRPELVAEVDFAGWTRDGIMRHPSFKGLREDKP
PNEVVRENPMEPKARESMRKQHVPAKTGRAKGAIKLTHPRKVLVPYTGLTKIGLADYYRE
VAGFMLPHVVGRPLSLVRCPGGLGEGCFFQRHPAGGVPHGVQGVRVLEKGHERTWLSVSD
LDGLLALVQLGVLEIHCWGARNEDLERPDRLVFDLDPGEDVEPARVTAAVLELREFLEGL
GLTGFAKATGGKGFHIVLPLQRKPGWQELREFARAVAEELAVRKPGGFVSVAGKARRSGR
IYIDWLRNARGASSIAPYSTRARPGAPVAVPLTWEELTAGFAPNSFDVQAVRSRVASLRA
DPWEGFFSLRQGLSASMWRALGRKRPAGSLI
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggccaggctcagcgaatactggcgcaagcgggatttttcgcgcacgcccgagccttcg
gggcgaggaccggagctcgagtcgggccgcgggttcgtgatccacaagcacaaggcgcgc
aggctgcactacgacctgcgcctggaactggatggcgtgctcctgtcctgggccgtgccg
cgcggaccgagcctcgatcctggccaaaaacggctggcggtgcgtgtggaagaccatccc
gtggagtatgggagcttcgagggcgtcattccgcagggcgagtacggcggcggcacggtc
atgctctgggaccgtggcgtttgggagcccgagggcgacccgcacgaaggtctgcgccag
ggcaagctgcacttccggctgcggggcgaaaagctttcgggcggctggattttggcgcac
atgagcggcaagcgggccaaggagaatgattggctgctcatcaaggtccgcgacgagcag
gctaaccaacggctcgatatagaaaccgaccggcccgagagtgcggtcacgggcaggacc
cttgcgcagatagcctcgtcggccgatcgcgtgtggagcggcgcgggcgaacatgcgtct
ggtaccgattctcgtcgagatgttcgtgaccgggaacggaccggagctgaagccgaaggc
gtgaccatcggcactctcgacggcgacgtgcgggccaggatcgccggaaatgtcggacct
gcgccgccggcggccgtcgaatacgccgacacacagccattgcctccaccagcgcagggc
caagcacggcccgaaaccctcacgataaaaaacaagacagcggagtccccgcgctccccc
ggcctgcccgatttcgcggccatgcccggcgcgcgacccggccccatgcccgagcagatc
cggccgcaactggccacgctcgtggactctcctcccgccggggagcagtggctgcacgaa
atcaagttcgacggataccggctgctgctgatcatcgataacagcaaggcgcggctcatg
actcgtggcggccaggactggacccatcgctttcccgaactggctagggccgccgggggc
ctgaccctgcggcgggccgtgctggacggcgaggccgtggtgctcgacgagcgcggccgt
ccggatttccaggccttgcagaacgtgctcaaggggctgagcgggggcacgctggccatg
tacctcttcgatatgccctatgccgagggccaggacctgtcaggctgcgcgctcatcgaa
cgcaaggaggccctgcggtccgttctgggcgcgataggtcagacaccttcacccttgcga
ttctcggaccatatcgtcggcaaagggaaacttgtgctggagaatgcctgccagatgggt
ctggagggcatcgtgagcaagcgcgccgacgcgcactacgagccccggcgcgcgcccacc
tggctcaaaagcaaatgcggccatcgccaggaagtggtcgtagcaggctggaccgatccc
aagggccagcgcacgggcttcggtgctctgctcgtgggcgtgcatgacaggcaaggccgc
ctgatctatgccggcaaggtcggcaccggctatgacacacaggtgcttggcgatctttca
ggtcgtctggccggtttggcgactgatgatgcggcctttgccgacacgcatcgtgtaggt
tcgctggcggatgtgcattgggtgcggccggaattggtggccgaggtggacttcgccggc
tggacccgcgacggcatcatgcgccatccgtcattcaagggcctgcgcgaggacaagccg
ccaaacgaagtggtgcgcgagaacccgatggagcccaaggctcgcgagtccatgcgcaaa
cagcatgttccggccaagaccggcagggccaagggggcgatcaagttgacgcatccgcgc
aaggtgctcgtcccgtacacgggcctgaccaagatagggctggcggactactaccgcgag
gtcgccgggttcatgctcccgcacgttgtcggccggcccttgagcctcgtgcgatgtccc
ggcggtctgggcgagggctgtttctttcagcgccacccggcgggcggagtgccgcacggt
gtgcaaggcgtgcgcgtgcttgaaaaaggccacgagcgcacctggctgagcgtgtcggat
ttggacgggctgcttgcgctggtgcagctcggtgtgctggagattcattgctggggtgcg
cgcaacgaggatttggaacggcctgatcggctggttttcgacttggaccccggcgaggac
gtggagccggcgcgcgtgaccgcagctgtcctggaattgcgcgagttcctggaggggctc
gggctcactggttttgccaaggccacgggcggcaagggttttcacattgtgctgccgctg
cagcgcaagcccggttggcaggagctgcgtgaattcgcgcgcgccgtggccgaggaatta
gccgtgcgcaagccgggtgggttcgtctccgtggcaggcaaggcccgccggagcggcagg
atctatatcgactggctgcgcaacgcccgaggcgcgagcagcattgcgccgtactccacg
cgggccaggccgggtgcgccagtggccgtgccgctgacctgggaggaactgaccgccggc
ttcgcgccgaattcgtttgatgttcaggccgtgcgcagccgcgtggcaagtttgcgggct
gatccctgggagggctttttcagcttgcgccaggggcttagcgcgtccatgtggcgcgcg
ctgggccgcaagcggccggcagggagtcttatctaa

DBGET integrated database retrieval system