KEGG   Desulfovibrio africanus: Desaf_3205Help
Entry
Desaf_3205        CDS       T01662                                 

Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase, NADH
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
daf  Desulfovibrio africanus
Pathway
daf00061  Fatty acid biosynthesis
daf00780  Biotin metabolism
daf01100  Metabolic pathways
daf01130  Biosynthesis of antibiotics
daf01212  Fatty acid metabolism
Module
daf_M00083  Fatty acid biosynthesis, elongation
daf_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:daf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Desaf_3205
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Desaf_3205
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Desaf_3205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:daf01004]
    Desaf_3205
Enzymes [BR:daf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Desaf_3205
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Desaf_3205
Lipid biosynthesis proteins [BR:daf01004]
 Fatty acid synthase
  Component type
   Desaf_3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: EGJ51498
UniProt: F3Z3F8
LinkDB All DBs
Position
3538526..3539290
Genome map
AA seq 254 aa AA seqDB search
MLLKDKKAAIFGVANDKSIAYGIAQQFKQHGARLSFSYPGEAIQKRVDPISEEIGGDFTF
PCDVTSDEQLAAAAQIVKEKWGSVDVLVHSVAFANRDDLKNRFIDTSRDGFKLALDISAY
SLVAMCKAFEPLLAPGASVMTMTYLGSTRVVTNYNVMGVAKAALEASMRYLSHEMGASGV
RVNAISAGPIKTLASSGISGFKSIFNHIEERAPLKRNVSIDDVGKTALYLASDLASGVTG
EVLFVDSGYNIMGL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcttaaagataagaaggccgccatcttcggcgtggccaacgacaaatccattgcc
tacggtattgcccagcagttcaagcaacatggcgcccggctcagcttcagctaccccggc
gaagccattcaaaagcgcgtcgatcccatcagcgaagagatcggcggagatttcaccttc
ccctgcgacgtgacctcggacgagcaactcgccgccgcggcccagatcgtaaaggagaaa
tggggcagcgtggacgtgctcgtgcactccgtggccttcgccaacagggacgatctcaag
aaccgcttcatcgacacctcgcgcgacggcttcaagctggccctggacatctcggcctat
tcgctcgtggccatgtgcaaggctttcgagcccctgctcgcgccgggcgcttccgtcatg
accatgacctatctgggttccacgcgggtggtcacgaactataacgtcatgggcgtggcc
aaggccgctctggaagcgagcatgcgctacctgtcccatgaaatgggagcctcgggcgtg
cgcgtcaacgccatcagcgcgggtccaatcaagaccttggcttccagcggcatctccggc
ttcaagtccatcttcaaccacatcgaggaaagagcgccgctcaagcgcaacgtcagcatt
gacgacgtgggcaagaccgccctctatctggcatcggatctcgcttccggcgtcaccggc
gaagtgcttttcgtggactccggctataacatcatgggactttaa

DBGET integrated database retrieval system