KEGG   Desulfosporosinus acidiphilus: Desaci_3087Help
Entry
Desaci_3087       CDS       T02148                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00010  Glycolysis / Gluconeogenesis
dai00030  Pentose phosphate pathway
dai00051  Fructose and mannose metabolism
dai00052  Galactose metabolism
dai00680  Methane metabolism
dai01100  Metabolic pathways
dai01110  Biosynthesis of secondary metabolites
dai01120  Microbial metabolism in diverse environments
dai01130  Biosynthesis of antibiotics
dai01200  Carbon metabolism
dai01230  Biosynthesis of amino acids
dai03018  RNA degradation
Module
dai_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaci_3087
   00030 Pentose phosphate pathway
    Desaci_3087
   00051 Fructose and mannose metabolism
    Desaci_3087
   00052 Galactose metabolism
    Desaci_3087
  09102 Energy metabolism
   00680 Methane metabolism
    Desaci_3087
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Desaci_3087
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:dai01009]
    Desaci_3087
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:dai03019]
    Desaci_3087
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desaci_3087
Protein phosphatases and associated proteins [BR:dai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desaci_3087
Messenger RNA biogenesis [BR:dai03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Desaci_3087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Methyltransf_18 Peripla_BP_1 Glycos_transf_1 TrmK
Motif
Other DBs
NCBI-ProteinID: AFM41994
UniProt: I4D870
LinkDB All DBs
Position
complement(3232980..3233951)
Genome map
AA seq 323 aa AA seqDB search
MAGEIQRIGVLTSGGDAPGMNAAVRAVVRKGIFHGLTIFGIHRGYEGLIHGELQEMSIGS
VADIVLRGGTVLKTARSEEMKTPAGQKKAFEQLQKRQIDALVVIGGDGSFRGAQTLAAQG
VRIIGIPGTIDNDIAGTDLTIGFDTAVNTVVDAVSKIRDTASSHDRTFIVEVMGRNCGNI
ALQAGLACGAESILVPEIPYDLDEISNKLKRGHQRGKNHSIILVSEGVGSAFKVGEELRA
RSGFETRITVLGHLQRGGNPSALDAVIAAAMGGKAVQSLLDQETNRMTAYINQTVISRPL
DDAYGTRRPLNRELYDLANELSI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggagattcagaggatcggggtacttacaagcggaggagatgccccaggcatg
aatgcagctgtacgggcagttgttcgtaaagggatttttcatggcttaacaattttcggt
attcatcgaggttatgaaggactcattcatggagaactacaagaaatgagtataggttct
gttgctgatatcgtactaaggggaggaactgtcctaaaaactgcccgctcggaagaaatg
aaaactccggcgggacagaaaaaggcttttgagcaactccaaaaacgccagatcgatgct
ctagttgttataggcggagatggttcctttagaggtgcacagactctagctgctcaagga
gttcggattatcggaattccgggtaccatcgataatgatattgccggaacggatttaacg
attgggtttgataccgcagttaataccgtggttgatgccgtaagtaaaattcgcgatacg
gcttcttcccacgatcggacatttatcgtagaggttatgggcagaaattgcgggaatatt
gctttacaggcagggttggcttgtggtgcagagtccattttagtgcctgagatcccttat
gatttagatgaaatcagcaataaattaaaaaggggtcaccagcgggggaaaaatcatagt
attatccttgtttcagaaggggttggcagtgctttcaaagttggtgaagaattgcgggcc
cgctcagggtttgagacccggatcacagttcttggtcacttgcagcgcggaggaaatccc
agtgcacttgacgccgtgattgctgcggccatgggaggaaaggcagtccagagcctttta
gatcaagagacaaatcgtatgacagcctatattaatcaaacggtaatttcccgtcctctc
gacgatgcttatggcacacggcgccccttaaatcgcgaactttatgatttagccaatgag
ttgtcaatttaa

DBGET integrated database retrieval system