KEGG   Desulfosporosinus acidiphilus: Desaci_4602Help
Entry
Desaci_4602       CDS       T02148                                 

Definition
(GenBank) transketolase, beta subunit
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00030  Pentose phosphate pathway
dai01100  Metabolic pathways
dai01110  Biosynthesis of secondary metabolites
dai01120  Microbial metabolism in diverse environments
dai01130  Biosynthesis of antibiotics
dai01200  Carbon metabolism
dai01230  Biosynthesis of amino acids
Module
dai_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:dai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desaci_4602
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Desaci_4602
Enzymes [BR:dai01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Desaci_4602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh XFP_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AFM43439
UniProt: I4DCB5
LinkDB All DBs
Position
complement(4812763..4813596)
Genome map
AA seq 277 aa AA seqDB search
MTTVELKRKANLIRQDIISMLVPAKSGHPGGSLSAADIVATLYFQEMRINPQEPNWADRD
RFVLSKGHAAPVLYAALAEKGYFPKEELQGLRQTGRMLQGHPDMKKTPGVDMSSGSLGQG
LSVANGIALAGKLEKKDYHVYALLGDGEMAEGQIWEAAMAAAHYKLDNLTAILDFNGLQI
DGTTDSVMSTAPLTDKWRAFCWNVIEVDGHDIEALQKAFAEAKQVKGKPTILIAKTVKGK
GVSFMEDQAGWHGNAPNAEQAEQALKELREEGLSLGE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaccactgttgaattaaaacggaaagcgaatctcattcgtcaagacattatttctatg
ctggtacctgcaaaatcaggccatcccgggggaagcctatcggcagccgatattgtggca
actctctatttccaagaaatgagaataaatccacaagaacccaattgggccgatcgagac
cgttttgttttatccaaaggtcatgcggcaccggttctctatgcagcgcttgctgaaaaa
gggtatttccccaaggaggaacttcaagggctgcgccaaacggggcgtatgctgcaggga
catccggatatgaaaaagactcccggagtcgatatgtcctcaggttccttagggcagggt
ctttccgtagccaatggcatcgctttagcaggaaagcttgagaagaaagactatcatgtt
tatgcgctgcttggtgacggagaaatggctgaaggacagatttgggaagcagcaatggct
gctgcacattataagctggataatcttacggccattttagactttaacggtttgcagatt
gacggaacgacggatagtgtcatgtcaaccgcaccactaaccgataagtggcgtgctttt
tgctggaatgtcattgaagttgacggccatgatattgaggccctgcaaaaggcctttgcc
gaagccaaacaagttaaaggaaaaccaacgattctcattgccaaaactgtgaaaggcaag
ggtgtttcctttatggaagatcaagccggttggcatggcaatgcaccgaatgctgagcaa
gctgaacaggccctcaaagaattacgagaggagggtttatcccttggcgaataa

DBGET integrated database retrieval system