KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1136Help
Entry
DaAHT2_1136       CDS       T01244                                 

Definition
(GenBank) Beta-ketoacyl synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00061  Fatty acid biosynthesis
dak00780  Biotin metabolism
dak01100  Metabolic pathways
dak01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DaAHT2_1136
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DaAHT2_1136
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dak01004]
    DaAHT2_1136
Enzymes [BR:dak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     DaAHT2_1136
Lipid biosynthesis proteins [BR:dak01004]
 Fatty acid synthase
  Component type
   DaAHT2_1136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N Raf1_HTH Raffinose_syn
Motif
Other DBs
NCBI-ProteinID: ADH85834
UniProt: D6Z2Q9
LinkDB All DBs
Position
complement(1349923..1351176)
Genome map
AA seq 417 aa AA seqDB search
MHGRPVKQRRVVVTGMGIVSCLGLSRREVQAALKAGTPGIALLPERKELGFQSGLSGVID
GFVPRYPLDRKYRSKLPEFGWWTWDALCQALEQAGVEAAELAGETRTGFLFGNDSSVVTG
VEQCEMLKAAGETRGIGSGHIFRLLTSTVTLNLCTKLQLRGASWTVSGACASGAMAIGQA
AELIAGGRQDRMLCGGGQEISWQSMCSFDAVGAFARREEAPHQASRPFDQGRDGLVPGGG
AAMLLLEAEETARARGAEILAEICGYDFAADGYHISVPSGEGMERAMAGAIADAGLEPEQ
IDLVMAHATSTPVGDEKEAQALCRLFELDRGKPGPLVAATKALTGHEFWMAGASQVIYAL
LMSRAGFVGPHPNLVEPAPEAAKLRIPTATLAQSPRFILCNAAGFGGVNASLVVQAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggcggccggttaaacaacggcgggtggtggtgaccggaatggggattgtctcc
tgcctggggttgtcgcgccgtgaggtgcaggcggcccttaaggccggcacccccgggatt
gccctgttgccggaacgcaaggaactgggtttccagagcggcctgagcggggtgattgac
ggctttgtgccgcgctatcccctggatcgcaaatatcgcagcaagctgccggaatttggc
tggtggacctgggacgccctgtgccaggccctggaacaggccggggtggaggcggccgag
ttggccggggagacccgcaccggctttctcttcggcaatgactcgtcggtggtcaccggg
gttgagcagtgcgagatgttgaaggcggccggggagacccgcgggatcggcagcggccat
atctttcgcctgctcaccagcactgtaaccttgaacctgtgcaccaagctgcagttgcgc
ggcgcttcctggacggtaagcggtgcctgtgccagcggcgcgatggccatcggtcaggcc
gccgagttgatcgccggagggcggcaggaccgtatgctttgcggcggcgggcaggagatt
tcctggcagtccatgtgcagcttcgatgcggtgggcgcttttgcccggcgggaagaggcc
ccgcaccaggcctcccgccccttcgatcagggccgggacggtctggtgcccggcggaggg
gcggccatgctgctgctggaggccgaagagacggcccgggcccggggggcggagattctg
gcggaaatctgcggttatgattttgccgccgacggctatcatatttccgttcccagcggc
gaggggatggaacgggccatggccggggccattgccgatgccgggctggagccggagcaa
attgacctggtgatggcccacgccacctccaccccggtgggcgatgagaaggaggcccag
gccctgtgccggcttttcgagctcgaccggggaaaaccggggccgctggtggcggcgacc
aaggccctgaccgggcacgagttctggatggccggggcctcccaggttatctatgccctg
ttgatgagccgggcgggctttgtcggcccgcatcccaacctggtcgagccggccccggag
gcagccaagctgcggatacccacggcaacgctggcccagtcgccgcgctttatcctgtgc
aacgcggcggggttcggcggggttaacgccagcttggtggtgcaggctttatga

DBGET integrated database retrieval system