KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1252Help
Entry
DaAHT2_1252       CDS       T01244                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dak  Desulfurivibrio alkaliphilus
Brite
Enzymes [BR:dak01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DaAHT2_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4902
Motif
Other DBs
NCBI-ProteinID: ADH85948
UniProt: D6Z323
LinkDB All DBs
Position
complement(1477999..1478598)
Genome map
AA seq 199 aa AA seqDB search
MTLVLPQLPYAQNALEPHISARTLEFHHGKHHQAYVDNGNKLLASSDLKGLPMEEIIKKT
AADPAAAGIFNNVAQVWNHSFYWQSMKPGGGGAPTGRIAAMIDADFGGLAGFAEAFKTAG
ATQFGSGWAWLVLDEASGRLKVVKTPNAETPLTMGMKPLLTMDVWEHAYYLDYQNRRPDY
MTTFVEKLINWDFVNANLG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgtattgccgcaactgccctatgcccagaatgccctggagccccacatcagc
gcccgtaccctggagtttcaccacggcaagcaccaccaggcctatgttgacaatggcaac
aaactgcttgcaagtagcgatctcaaggggctgccgatggaggaaattattaaaaaaacc
gcggccgatccggcggcagccggcatcttcaacaacgtggcccaggtctggaaccactcc
ttttactggcagagcatgaagccgggtgggggcggggcgcccaccggcaggatcgccgcc
atgattgatgccgacttcggcggcctggccggttttgcggaagcgtttaaaaccgcgggc
gccacccagttcggcagcggctgggcctggctggtgctggacgaggcctcggggcggctc
aaggtggtcaagacacccaatgccgaaacacccctgaccatggggatgaagccgctgctg
accatggatgtctgggagcacgcctattatctggattatcagaatcggcgtcccgattat
atgaccacctttgtcgaaaagttgatcaactgggacttcgtcaacgccaacctgggctga

DBGET integrated database retrieval system