KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1643Help
Entry
DaAHT2_1643       CDS       T01244                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00620  Pyruvate metabolism
dak00680  Methane metabolism
dak01100  Metabolic pathways
dak01120  Microbial metabolism in diverse environments
dak01200  Carbon metabolism
Module
dak_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DaAHT2_1643
  09102 Energy metabolism
   00680 Methane metabolism
    DaAHT2_1643
Enzymes [BR:dak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DaAHT2_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ADH86336
UniProt: D6Z461
LinkDB All DBs
Position
complement(1924218..1927133)
Genome map
AA seq 971 aa AA seqDB search
MEPGVFTSTLTGWQPEDSATLAGQVGLLGRLLGRSIKELRGAAVLEQVEDLRQLCKQAMV
ENRPELRRQVAQRIADLDCREIVHLLHAYTAFFHLVNKVEQMEITRVYREPDPSPPPATP
GENSRRRETIDAAVRGLKEQGCSLQQTLAVLSRLDIQPTLTAHPTEARRRSILYKQKQVA
SLLGRLRREALTTDERDELLGEISNQIGLLLTTDDIRQTRPTVDDEVESGLYFVRNAIWA
TVPRIYRDLRAALWRHYGESPEILPVLLRFRSWIGSDRDGNPNVTAAVSRRTYHYQRRVV
LQLYLDELCELRRELSLSSRQAPPSEALRNSLEEDGRTLAIDEQRRRHYRNEPYRLKITY
IMARLRSLLWQMENRPRELAAGDYHCPAFLADLQLLAASLRESGFSRLVSQGRLGRLLVR
VRTFGFHLVALDFRQHSQVHEETVALLLRLAGVEEDYLSLPEERRLALLQEELGNPRPLL
PRGCELPPEARDLLETLALIGELQRLDPASVGSYIISMTHQVSDLLEVLLLAKEAGIWRL
RDGGVESRLQLVPLFETIEDLELSGRLVEKMLANPVYRQHLAAQNDFQEVMLGYSDSNKD
GGYWMANWALHRAQERLGQVCRQYGVDLRLFHGRGGTVGRGGGRSSQAIVAMPEVVHNGR
IRFTEQGEVISFRYAFADLAHRHLEQIFYAMIRTAGRVARLAEQQAEPGAAGEAVEAAAD
AEPGRLEGIEAGVAPERLQEFSALMDEVAQRSMQAYRELVRDPEFWAWYTRVTPIEQISR
LPIASRPVSRKAAGDVDLDGLRAIPWVFAWIQTRYIVPGWYGVGAALGELSGTERGRQTL
KQMYEQWPFFRMLIDNARREMGRTRLEIAADYAALANDLAVKDFHAQISRDFAEGRQALL
ELSGEEELLGGSPEVQRSIALRNPYTDVLNLLQVELLRRYHDSGGDEEREALWDALFLSV
NGIAAAMQSTG
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaggcgtatttacttcaactctcaccggctggcagccggaggattcggccacc
ctggccggccaggtcggcttgctgggccgtttgttgggtcgctccatcaaggagttgcga
ggggcggcggtgctggagcaggtggaggatctgcgccagttatgcaagcaggccatggtg
gaaaaccggccggaactgcgccgccaggtggcccagcggattgccgatctggattgccgg
gagatcgtccacctgctgcacgcctataccgccttttttcacctggtcaataaagtggaa
cagatggagatcacccgggtataccgcgagccggacccatcgccgccgccggcaaccccc
ggtgaaaactcacgccggcgggagaccatcgatgcggcggtgcggggtcttaaggagcag
ggctgcagcttgcagcagaccctggcggtgctttcccggctggacattcagcccaccctc
accgcgcaccccaccgaggcccggcgccgcagcattctctacaagcagaagcaggtagcc
tccctgttggggcgcttgcgccgggaagccttgaccactgatgagcgggacgaactgctg
ggggaaatttccaaccagatcggattgttgctgaccaccgacgatatccggcaaacccgc
cccacggtggacgatgaggtggaaagcggcctgtactttgtccgcaacgctatctgggcc
acggtgccgcgcatttaccgcgacctgcgggcggctctctggcggcattacggcgaaagc
ccggagattctgccggtactgctccgctttcgttcctggatcggcagcgatcgggacggc
aaccccaacgtcaccgccgctgtcagccgccggacctatcattatcagcggcgggtggtg
ctgcagctttaccttgatgaactttgcgaattacgccgggagctcagcctttcttcccgc
caggcccctccctctgaagccctgcgtaactccctggaagaagacggccgcaccctggcc
attgatgagcagcgccgtcggcattaccggaatgagccctatcgcttgaaaatcacctat
atcatggcgcgcttgagaagcttgctgtggcagatggaaaaccgtccccgggaattggcc
gccggcgattaccattgccctgcctttcttgccgacctgcaactgttggccgccagcctg
cgggaaagcggtttcagccggctggtcagccagggccgcctggggcgcttgctggtgcgg
gtgcggaccttcggctttcacctggtggcgctggattttcgtcagcacagccaggtgcat
gaagagacggtggccttgctgctgcgcctggccggggtggaggaagattacctgtccctg
cccgaagagcggcgcctggcgctgctgcaggaggaactcggcaacccccgcccccttttg
ccccgggggtgcgagttgccccccgaggctcgggatctgttggaaacactggctttaatc
ggagagctgcagcggctcgacccggcctcggtgggcagttatatcatcagcatgacccat
caggtcagtgatctgctggaggtgctgctgttggccaaggaagcgggaatctggcggctg
cgcgatggtggggtggaaagccgcctgcaactggtgccgttgtttgaaaccattgaagac
ctggaactttccggccggctggtggagaagatgctggccaatccggtataccgccagcac
ctggcggcccagaacgatttccaggaggtgatgctgggctattcggacagcaacaaggac
ggcggctactggatggccaactgggccctgcaccgggcccaggagcgtctggggcaggtc
tgccggcaatatggggtcgatctgcggctttttcacggtcgcggcggcactgtagggcgg
ggcggcgggcgctccagtcaggccattgtggccatgccggaggtggtccacaacgggcgc
atccgcttcaccgagcagggggaggtgatctccttccgctacgcctttgccgatctggcc
caccggcatctggaacagatcttttatgccatgatccggacggcggggcgagtggccagg
ctggccgagcaacaagcagagccgggggcggccggggaggcggtagaagcggccgccgat
gctgagcccggccggctggagggaattgaagccggggttgcccctgagcggctgcaggag
ttttccgctttaatggatgaagtggcccagcgcagtatgcaggcttaccgggagctggtg
cgggacccggaattctgggcctggtacaccagggttacccccattgagcagatcagccga
ctgcccatcgcctcccgcccggtttcccgcaaggccgccggcgatgtcgatctggacggc
ctgcgggccatcccctgggtctttgcctggattcagacccgttatatcgtgcccggctgg
tatggcgtcggcgcggccctgggtgaattatccggcaccgagcgcgggcggcagacctta
aagcagatgtacgagcagtggcctttttttcggatgctgatcgacaacgcccgccgcgag
atgggccgcacccggctggagatcgccgccgactacgctgctttggccaacgatctggcc
gtgaaggattttcatgcccagatcagccgggattttgccgagggccggcaagcgttgctg
gagctgagcggggaggaggaactgctgggcggcagccccgaggtccagcgttccattgcc
ctgcgcaacccttacaccgacgtccttaacctgctgcaggtggaactgctgcgccgctac
cacgattccggcggcgacgaggagcgcgaggccctctgggatgccctcttcctcagcgtc
aacggcatcgccgccgccatgcagagcaccggctga

DBGET integrated database retrieval system