KEGG   Desulfurivibrio alkaliphilus: DaAHT2_1971Help
Entry
DaAHT2_1971       CDS       T01244                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dak  Desulfurivibrio alkaliphilus
Pathway
dak00473  D-Alanine metabolism
dak00550  Peptidoglycan biosynthesis
dak01100  Metabolic pathways
dak01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DaAHT2_1971
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DaAHT2_1971
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DaAHT2_1971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dak01011]
    DaAHT2_1971
Enzymes [BR:dak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DaAHT2_1971
Peptidoglycan biosynthesis and degradation proteins [BR:dak01011]
 Precursor biosynthesis
  Amino acid ligase
   DaAHT2_1971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ADH86649
UniProt: D6Z524
LinkDB All DBs
Position
complement(2286662..2287609)
Genome map
AA seq 315 aa AA seqDB search
MAKKEKLRVALLAGGKSGEREVSLAGAREVEKAINTERYDVRRYDPATDLARLVADAPQL
DVAFILLHGPLGEDGSIQGLLDLLEIPYQGSGVLGSALAMDKDLAKQLYRHAGLLVPAWE
MAGSADLDDPARLLQSLKLPLVVKPVRQGSSLGMSLVDQPAELVPALKLAFDFDDQVMVE
EFIAGRELTGGVLGNADLTPLPVVEIIPGKEYRFFDYQAKYQAGATREICPAQLPAEVTA
EVQRCACLAHQALNLRGYSRTDMILAEGGLYVLETNTIPGMTPTSLLPQAAATHGLSFGA
LLDRLLELALEGRGK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaagaaaaattgcgggtggcgttgctggccggtggcaaatccggtgagcgc
gaggtttctctggccggcgccagagaggttgaaaaggccatcaacacagagcgatacgat
gtgcgccgctatgatccggccaccgaccttgcccgcttggtggccgatgccccgcagctc
gatgtggcctttatcctcctgcacggtcccttgggcgaagacggcagcatccagggcctg
ctggacctgctggagatcccctatcagggcagtggggtcttgggcagcgccctggccatg
gacaaagacctggccaagcagctctaccgccatgccggcctgctggtcccggcctgggag
atggccgggtcggctgacctggacgatcccgctcggctgctacagtcccttaagctgcca
ctggtggtcaagccggtacggcagggctccagcctgggcatgagtctggtcgatcagccg
gccgaactggtaccggcccttaaactggcctttgattttgacgatcaggttatggtcgag
gaatttattgccggccgggaactgaccggcggggtactgggcaatgccgatcttaccccc
ctgccggtggtggagattatccctggcaaggaatatcgcttcttcgactatcaggccaag
tatcaggccggcgccacccgggagatctgccccgcccaacttcccgccgaggtcaccgcc
gaggtccagcgttgcgcttgtctggcccatcaggccttgaatctgcgcggctacagccgc
accgacatgatcctggccgagggtggcctctatgtgctggaaaccaataccatcccgggg
atgacccccaccagtctgttgcctcaggccgcagcgacccatggcctgagttttggagcg
ttactggaccgattgctggaactggctctggaaggcaggggaaaatag

DBGET integrated database retrieval system