KEGG   Desulfatibacillum alkenivorans: Dalk_3595Help
Entry
Dalk_3595         CDS       T00813                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
dal  Desulfatibacillum alkenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like ABC1 Kdo Pkinase_fungal RIO1 zinc_ribbon_15
Motif
Other DBs
NCBI-ProteinID: ACL05283
UniProt: B8FGQ3
LinkDB All DBs
Position
4543672..4545618
Genome map
AA seq 648 aa AA seqDB search
MDDIQALSQSGRYLNPRLLGSGATANVYAARNLKTGRDVAVKILHPSLARDAANLEQFKR
EIQIARLVKHPGMVPVYNMMRLKGRVCMEMELLRGMTLKQYLHSQGRLSLSLAAKIGTKI
AGILQACHKNNVIHRDLKPQNIFLTKDGRVRILDFGIAKMTAVNDLTKTGVSLGTPEYMA
PELFAGSSSDPRTDLYSLGIILFEMIAGRPPFQGDSIAELFTTHLRTPVPNLQEYNPQTP
VWLKEAVNKLLEKNPVNRYQCVEEFLLDCKTRNVAANALPSLNKAPCIHCGNETIKNLPF
CVFCGFGFSQASRDGRFRLVRNVGHRNFRIPKSEKRELLSFINETFDLDLKKIPAHRKVL
LTGVDKMFAELVQKKAERKNIFLQVHEISGVKDSTTEALRLTTFLLPILYLILFLRYFVL
LIFEVTTRASSLQFILPLIVAVAAGALVFAISASIIVRSSLEPILKHKDIFSKDLFQDAK
WLRNVSDALQKPRTDEMRLTLAQSIERILLLKENAGDVPGQGLEMEKMKELILISARVAN
LASEVDNVLTQIDWHGLDAERLTDKALKGEMFYMDLLVQYQDLQEKRDSLMARFNELRFT
LNRLCSQTLVLKMELERDVLEEYESGLKSLEKELGALAEVRLEVTSLV
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggacgatattcaagcactgtcccaaagcggacgctacctcaaccccagactgctgggc
tcgggcgcgacggccaacgtgtatgcggctcgcaacctgaagaccggccgggatgttgcg
gtgaaaatcctgcatcccagcctggcccgggacgccgccaacctggagcagttcaagcgg
gaaattcaaatagcccggctggtgaagcaccccggcatggttccggtttacaacatgatg
cgcctgaaagggcgggtttgcatggaaatggagctgctgcggggcatgaccttaaagcag
tatctccacagtcagggaagattgtccctaagcctggccgctaaaatcgggacgaaaatc
gccggcattctccaggcgtgccacaaaaacaacgtcattcaccgggacctgaagccgcaa
aatattttcctcaccaaggacggccgggtgaggattttggactttggcatcgccaagatg
acggccgtcaacgatctgaccaagaccggggtttccctgggcaccccggagtacatggcg
ccggagctgttcgccgggtcgtcgtcggacccccgaaccgacctgtacagcctggggatc
atcctttttgaaatgatcgccggccggccgccttttcagggcgactccatcgccgagctg
ttcacaacgcaccttcgcaccccggttcccaatctccaggagtacaacccccaaaccccg
gtctggctgaaagaggccgttaacaagctgctggaaaaaaatccggtcaacagataccag
tgcgtggaggagttcctgctggattgcaaaacccgaaatgtggccgccaatgccctgccc
agcctgaacaaggcgccctgcatccattgcgggaatgaaaccatcaaaaacctgcctttt
tgcgttttttgcgggttcggcttttcccaagcctcgcgggacggaagattccggctggtt
cgcaatgtgggccatcggaacttccgcataccgaaatccgagaagcgggagttgttgtcc
tttatcaatgaaacctttgacctggacttgaaaaagattcccgcccaccgaaaagtcctg
cttacgggcgtggacaaaatgtttgcggaactggttcaaaaaaaggcggaacgtaaaaac
atctttctgcaagtgcacgagatttcgggcgtcaaagactcaaccacggaagcgctccgg
ctgacgaccttcctgcttcccattctttatctgatcttatttctgcgttatttcgtcctt
ctcatttttgaagtcaccacccgggcctcgtccttgcaatttatactgccgcttatagtg
gcggtcgccgccggcgcattagtgttcgccatatcagcctccattatcgtccgatcaagc
ctggagcccattctcaagcataaggacatcttctcaaaggatttgttccaggacgccaaa
tggcttcgcaatgtgtccgacgccctgcaaaaacccaggaccgatgaaatgcgattgacg
ctggcgcaaagcattgagcggatccttctgcttaaggaaaacgccggcgacgttccgggc
cagggcctggaaatggaaaaaatgaaggaattgattcttatcagcgcccgcgtagccaac
ctggccagcgaggtggacaacgtgctcacgcaaattgactggcacggactggacgccgag
cgcctgacggacaaggccttgaaaggcgaaatgttctacatggacctcttggtgcaatat
caggatttgcaggaaaagcgcgactccctcatggcccggttcaacgaattgcgctttacc
ctgaatcgcttgtgctcccagaccctggttttgaaaatggaattggagcgggacgtgctg
gaggaatatgagtccggcctgaaatcccttgaaaaagagcttggcgcgttggctgaagtg
aggctggaggtgacatccctggtatga

DBGET integrated database retrieval system