KEGG   Drosophila ananassae: 6494316
Entry
6494316           CDS       T01059                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B isoform X1
  KO
K20017  Bcl-2 family protein
Organism
dan  Drosophila ananassae
Pathway
dan04214  Apoptosis - fly
dan04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6494316
   04215 Apoptosis - multiple species
    6494316
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6494316
NCBI-ProteinID: XP_001960545
FlyBase: FBgn0088492
UniProt: B3MCW5
LinkDB
Position
Unknown
AA seq 298 aa
MPGTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGGGPRETTRR
RLSNVSDVVTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQRI
RSILGSTSMGIVRDVFPAVQVLGDELERMHPRVYSGVARQICRNPGGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTSNSLNPLEWTTLVIGVVFGLILFFMILRFIISTIVPKIYQRFTN
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcccggcacctcgtatcccacgaataatgataatttcagcaacggattcccaatggcc
accacacaaagtgaacgactgttgcaggcccagaatcgaaggaagttcagctttcccgcc
actctccattcagcttccttgttggaagtgggcggaggcccgcgggagacgacaaggcgg
aggctaagcaatgtcagcgatgtggtcacccggaagctgtcctacacgattggctggaag
gcggcgcaaattccagcacaggacatcattacgcagggtcgttgtctatgcggccactac
atcaaacgacgcttgagaagatcgggcttgtttaataaaaaactgggtctccagcgcatt
cgaagcattcttggatcgacttccatgggcatcgtaagagatgtgtttccagccgttcaa
gtgctgggtgacgaactggagcggatgcatccgcgggtctacagtggagtggctcgtcag
atatgccgcaatcctggtggagagttccatacacctgatgcagtgagtctcctcctgggt
gccgtcggtcgagagctcttccgggtggagataacctggagcaaggtcatatcactgttt
gcgatagccggtggcctctccgtcgattgtgtgcgtcaggggcatccggagtacctgcca
aaactaatggagagtgtatccgaggtgatcgaagatgagctggttccttggatcaatgaa
aacggtggatggagtggcataaatacccatgttctgcccacttccaatagcctgaatcca
ttggaatggacaaccttagttattggtgttgtttttggcttgatcttattttttatgatc
ttgcggtttataataagcacgatagtaccgaaaatataccaacgatttaccaactga

DBGET integrated database retrieval system