KEGG   Drosophila ananassae: 6495907
Entry
6495907           CDS       T01059                                 

Definition
(RefSeq) caspase-1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dan  Drosophila ananassae
Pathway
dan04214  Apoptosis - fly
dan04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6495907
   04215 Apoptosis - multiple species
    6495907
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dan01002]
    6495907
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     6495907
Peptidases and inhibitors [BR:dan01002]
 Cysteine peptidases
  Family C14: caspase family
   6495907
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 6495907
NCBI-ProteinID: XP_001959834
FlyBase: FBgn0090097
UniProt: B3MFH1
LinkDB
Position
Unknown
AA seq 326 aa
MTDECITRNFNVLSSNGAGNRSSIIADNTDAKGCPGGGVVVGGGGGAATAAGAPPVVANK
LVARMPVDRYASEYNMNHKNRGVALIFNHEFFDIPSLKSRSGTNVDSAELKLALEGLGFS
VSVHKDCKLLDILKYVEKAASQDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFT
ANFCPTLAGKPKLFFIQACQGDRLDGGMTLEKSTTETDGDSSMSYKIPIHSDFLFSYSTI
PGYYSWRNINNGSWFMQSLIRELNTNGKKYDILTLLTFVNQRVAIDFESNVPGTPMMDRQ
KQIPCLTSMLTRILRFSDKPNGNKAG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgacggacgaatgcataaccagaaacttcaatgttctcagctcgaatggagcgggaaat
cgaagcagcattattgctgataataccgatgccaagggctgcccggggggcggtgttgtt
gtcggcggtggcggtggtgcagcaactgcagcgggcgctccgcccgttgtggccaacaag
ttggtggcccgaatgccggtggatcgttacgcctccgaatacaatatgaatcacaagaat
cgcggagtggccctaatcttcaaccacgaattctttgatattccctcactcaagagccgt
tccggcaccaatgtggattccgccgaactgaagttggccctggagggtctgggcttcagt
gtgtcggtgcacaaggactgcaagttgctggacatcctcaagtacgtggagaaagcagct
tcccaggatcacacggacaacgactgcctggcagtggccattctgtcgcatggagaacat
ggctatctgtacgccaaggacactcagtacaagctggacaacatctggcactatttcacg
gccaacttctgccccacgctggccggcaaaccaaagctgttcttcatccaggcctgccag
ggcgatcgtctggacggcggaatgactctcgagaagagcacaaccgaaacggatggcgac
tcctcgatgagctacaagatacccatacattcggactttctcttctcctactccaccatt
ccaggctactactcctggcgcaacatcaacaacgggtcctggtttatgcagtccctgatc
cgagagctcaacaccaatggcaagaagtacgacatcctcaccctgctcacattcgtcaat
cagcgcgtcgccatcgactttgagtcgaacgtgcccggcacccccatgatggatcgccag
aagcagataccgtgcctcacctccatgctgacgcgcatactgcgcttcagtgacaaaccg
aatggcaacaaggctggctaa

DBGET integrated database retrieval system