KEGG   Drosophila ananassae: 6498294
Entry
6498294           CDS       T01059                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dan  Drosophila ananassae
Pathway
dan00230  Purine metabolism
dan01100  Metabolic pathways
dan04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6498294
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6498294
Enzymes [BR:dan01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     6498294
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 6498294
NCBI-ProteinID: XP_001962479
FlyBase: FBgn0092511
UniProt: B3ML82
LinkDB
Position
Unknown
AA seq 1177 aa
MPEEKGTSLENGGQAAANSTPTKTKPQQRQKTPPARRRPNDSDVVAGGVGITGGGVVILP
QHVLNELYHNYSIKQRRSGLKWFLFAAVLFNIWTIVIPWDQAMATRVVNCCMLLAYLALT
ALLHIGRGSEKPTLKRLHEILLTIIPRALWLLSILHFVAYVILQPSFSPRDVLGWAILLN
FLVYVTLPLPLIFLGLSIGCCSYLICLSLPVAYSRQDPMLSNQVAANAVLIATAALIGLL
YYFMGEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEA
FKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKIL
GDCYYCISGAPDERPDHAVMCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILG
QRQWQFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKREELLRIAG
LKTYFITKVVKPFASPCAKKINETQAENLHSSPNGSTNEAITGADDNDGLDDEELLAQTV
VSNGHQTPGEEDEEEQVKLENFKQRLKDELVTRDGHENLIKDTNVFLRFKNPQLEQSYAV
YREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVVISIAESFSGM
LPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVVDMFFFVTFVRTEHIVSESEFNATA
GMEGVEVDVEDSGVVTAEHLLPASFVEQMREAVPTERVLYPSYLSNFGVLILIAIAVIAQ
LTHLTKILLLLSIAALHCYFNIFIMQDLYSLEDDLSHQPLISTRYCTSGLLLVAALALST
LARHMDHEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDL
YSQSYAEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKI
KTIGSTYMAASGINLQRNLRNDAPIIERWSHLAVLVEFALELKHALQGINEQSFNHFVLK
MGINHGPITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTEETCNILQEFGYTFL
QRGLVAVKGKGQLMTYYLQGKSQPNAEPAAPTSAIELHGPESTTLESTTELEASDIKTPL
LKVKAQEATAESEGIAQESSLGNGSAGQVGESQSLLE
NT seq 3534 nt   +upstreamnt  +downstreamnt
atgccggaggaaaagggcaccagcttggagaatggcggccaggcggcggccaattccacg
cccacaaaaacaaagccccaacaacgccagaagacaccgccagcccgccgacggcccaat
gacagcgatgtggtggccggtggtgtgggtatcactggcggcggagtcgtgatcctgccg
cagcatgtgctcaacgaactataccacaactactccatcaagcagcgacgcagcggcctc
aagtggttcctgtttgcggccgtgctattcaacatatggactattgtaattccctgggat
caagcaatggccacaagagtggtaaactgttgcatgctgctggcttacttggctctaacg
gctctgctccacatcggacgtggctcggagaaaccaaccttaaaaaggctccatgagatc
ctcctgacgataatccctcgggccttgtggctacttagcattctacactttgtggcatat
gttatcctgcaaccaagtttctcgcctagagatgtccttggctgggctattcttctcaac
ttcctggtctatgtgaccctgccgctgcctctgatattcctcgggctgtcgattggctgc
tgctcttatttgatatgccttagtctgcccgtggcttactctcgccaggatccaatgctc
tccaatcaggtggcggccaatgctgtccttatagccaccgccgccctcatcggactcctg
tactactttatgggcgaggccaagcagaagcgggccttcctggaggccaaaaagagcctt
gaggtgaaaatggtcatcgaggagcagtctgccgagcaggagcgattgctgctgtcggtg
cttccaaagcatgtggctataaaaatgcgagaagacttgggatcctctagttctgaggct
ttcaagaagatctatatgagccgtcacgagaatgtgagcatactctatgcggatatcgtt
ggcttcacagccatctcctcgacatatagcgcccaagatttggttaaaatgcttaacgag
ctcttcgcacgcttcgataggctcgccgagaaatatcaacaattgcgcatcaagattctt
ggcgattgctattattgcattagtggtgcccccgacgagcgaccggatcacgccgtcatg
tgcgtgcacatgggactctccatggtgaaggccatcaagtatgtgcagcagaaggccaac
tcacctgttgatatgcgtgtgggaatacacacgggagcagtgctagccggcattctcggc
caaaggcagtggcagtttgacgtctactccaaggatgtcgagttggctaataaaatggaa
tcgagcggcaaggctggacgcgtccatatttcggacaaaacactggccttcctcaacggc
gagttcgaggtggagcccgcctttggggagaaacgggaggagctgctacggattgccgga
ctgaagacctatttcatcaccaaggtggtgaagccgtttgcctcgccatgtgccaagaaa
atcaacgaaactcaagcggaaaacctccatagcagtcccaatggttcaaccaacgaagcc
ataaccggcgcggacgacaacgacggcctggacgatgaggagcttctggcccagactgtc
gtgtccaacggccatcaaacacccggcgaggaggacgaagaggagcaggtcaagcttgag
aactttaagcaacgattgaaagacgaactcgtgactcgtgatggacatgagaacctcatc
aaggacaccaatgtattcctacgctttaagaatccccagctggagcagtcgtacgccgtt
tacagggagccgtacagttccctgccgttgctggccgctctcctggtccagtgcattgat
gttctctactcctacctggtgcttccccgatccacgctccacttcatcaatatcgcagca
cccttagttccaatcgccatgctggtggtcatcagcatagccgagagcttcagcggaatg
ctacccaagttcttcgtcgatgtgagcaagagattcaatgacattaccttcgtccgggag
ctggccgccataatcatagcacttaccattggtctaagcaacgttgtcgacatgttcttc
ttcgtcaccttcgttcgcaccgagcacattgtgagcgaaagcgaattcaatgccacggcc
ggaatggagggcgtcgaagtggacgtggaggattcaggggtggtcacagccgagcacctg
ctgcccgcatcgtttgtggagcaaatgcgcgaggcagtacctacagaacgtgtcctatat
ccgtcctacttgagtaatttcggtgtccttatattgattgcgattgccgtaattgctcag
ctcacgcatcttacaaagattttgttgctgctatccattgcagctctgcattgctacttc
aatatattcattatgcaggacctgtactccttggaagatgatttgtcacaccaacctctc
atatcaacacgttactgcacttctggactcttattggtggctgctttggcgctcagcact
ttagccagacatatggatcacgaagatcgtgtgatttttaagtggaagacagaggtggcc
gagcagaaggagactgccaacgacatgcgacagcggaatgaggccttagtctacaacgtc
ctacccgttcatgtggcagagcacttcatgaagaacaccaaacgctcccacgacgacctc
tactcccagagctatgccgaagtgggagttctattcgccagtatgccaaacttttcagac
ttttattcggaggagactgttaacaatcagggtctggagtgcctgcggtttctgaatgaa
gttatctccgattttgacgccttgctggagctccctcagttccaggacatcatcaaaatt
aagacaattggctcaacctacatggccgccagtggcattaatctgcagcgtaaccttcga
aacgacgctcccatcatagaacgctggtcccacctggccgtcctggtggagtttgccctg
gaactgaagcacgccctgcagggcattaacgagcagtcgttcaatcacttcgtcctcaaa
atgggcatcaatcatggcccgataacggcgggcgttattggtgcccgaaagccgcactac
gatatctggggtaacaccgtcaacgtggcgtcgcgcatggagagcaccggcaaggcagga
gccattcaggtcaccgaggagacatgcaacatcctgcaagagttcggctacaccttcctg
caacgcggtctagtggctgtcaaaggaaaaggccagttgatgacctactacttgcagggt
aaatcccagccaaatgcggaacctgctgcgccgacatccgccattgagctgcatggcccg
gaatcgacgactctggaatccaccaccgaactggaggcctccgacatcaagacaccgctg
ctgaaggtgaaggcgcaggaagcgacggcggagagcgagggaatcgcccaggagtcgagt
ctgggaaacggcagtgctggccaagtgggggaatctcaatccttgctagaataa

DBGET integrated database retrieval system