KEGG   Drosophila ananassae: Dana_GF10773Help
Entry
Dana_GF10773      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
dan  Drosophila ananassae
Pathway
dan00010  Glycolysis / Gluconeogenesis
dan00053  Ascorbate and aldarate metabolism
dan00071  Fatty acid degradation
dan00260  Glycine, serine and threonine metabolism
dan00280  Valine, leucine and isoleucine degradation
dan00310  Lysine degradation
dan00330  Arginine and proline metabolism
dan00340  Histidine metabolism
dan00380  Tryptophan metabolism
dan00410  beta-Alanine metabolism
dan00561  Glycerolipid metabolism
dan00620  Pyruvate metabolism
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF10773
   00053 Ascorbate and aldarate metabolism
    Dana_GF10773
   00620 Pyruvate metabolism
    Dana_GF10773
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dana_GF10773
   00561 Glycerolipid metabolism
    Dana_GF10773
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dana_GF10773
   00280 Valine, leucine and isoleucine degradation
    Dana_GF10773
   00310 Lysine degradation
    Dana_GF10773
   00330 Arginine and proline metabolism
    Dana_GF10773
   00340 Histidine metabolism
    Dana_GF10773
   00380 Tryptophan metabolism
    Dana_GF10773
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dana_GF10773
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Dana_GF10773
    1.2.1.8  betaine-aldehyde dehydrogenase
     Dana_GF10773
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     Dana_GF10773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 6493640
NCBI-ProteinID: XP_001958146
FlyBase: FBgn0087813
UniProt: B3M7M4
LinkDB All DBs
Position
Unknown
AA seq 537 aa AA seqDB search
MIANLRNLSRLALPRRLASQSYSSSSFLIDQPEYSFLKELGLERENPGVYSGHWQGRGPS
VTSYDPGTGQAIATVRQGTVQELEQTIGLAVDAYKQWRKVPAPVRGEIVRQIGDELRKYK
EPLGKLVSLEVGKIYSEGQGEVQEFIDICDYAVGLSRIYSGQLINSERADHSILEAWRPL
GLVGVISAYNFPNAVFGWNAAIALTTGNSVLWKGAPSTPLVSVATTKIVADVLQRNNLPP
VVTLCQGGTDVGQSLVSDKRVNLVSFTGSCQTGRDVGVEVQKRFGKVILELGGNNALIID
ESANVKMALDAALFGCIGTSGQRCTTTRRIIVHEKLHDQFVQALVSKYKQLIPKIGHQLE
AQTLVGPVHTQQNVENYKKAIEEAKSLGGTVAFGGKVIQRDGFYVEPTVVTGLPHDATVV
HRETFAPIVYILKAKNVEQAIEWNNEVEQGLSSAIFTENIGQAFKWIGASGSDCGIVNIN
TTTNGAEIGGAFGGEKATGGGRESGSDAWKQYCKRATITVNHSGELACAQGVVFNVE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgaatttgagaaacctttcccgactggccttgccccgtcgactggcctcccaa
tcctattcctcctcctcattcctgatcgaccaaccggaatatagtttcctgaaggaactg
ggattggaacgagagaatcctggagtgtactctggtcattggcagggacgaggtccaagt
gtcaccagctacgatcctggtactggccaagcaatcgccacagtgcgccagggcacggtc
caggaactggagcagaccatcggattggctgtggacgcctacaagcagtggcggaaagta
cccgctccagttcgaggcgaaatagttcgccagatcggagatgagctgcgcaagtacaag
gaacctttgggtaaacttgtttccctggaggtgggaaaaatctacagtgagggtcagggt
gaggtgcaggagttcatcgatatctgcgactatgcggtgggtctctccaggatctattcc
ggtcagttgatcaactcggagcgtgctgatcactcgattctggaggcttggcgtcctctg
ggattggtgggtgtaatttcggcttacaatttccccaacgccgtattcggatggaatgca
gctattgctctaaccactggcaacagtgttctgtggaagggagcacccagcactcccttg
gtttccgtggccaccaccaagatagtagccgatgtgttgcagaggaacaacctgccgccg
gtggttacactctgccaaggaggcaccgatgtaggacagtctttggtttccgataagcga
gtaaacctggtctccttcactggtagctgccaaactggtcgggatgtcggcgtagaagtt
cagaaacgcttcggaaaggtgatcctcgaactgggcggcaacaatgccctgattatagat
gaatctgcgaacgttaagatggccctggatgcggctcttttcggctgtatcggaactagt
ggccagagatgcaccaccaccaggagaatcattgtccacgagaagctccacgaccaattt
gtacaggctctggtcagcaaatacaagcaactgatacccaagattggacaccaattggag
gcacaaactctcgtgggtcccgttcacacgcaacagaatgtggagaactacaagaaagcc
atcgaggaagccaagtccttgggtggaactgttgccttcggcggtaaggtcatacagcga
gatggtttttatgttgagcccactgtagtcacgggattgccacatgatgccaccgttgtc
catcgcgaaacttttgcgccaatcgtctatatcttgaaggcgaagaatgtggaacaggcc
attgaatggaacaacgaggtggagcagggtctctcctcagctattttcaccgagaacatc
ggtcaggccttcaagtggattggagctagtggctccgattgcggcatcgtgaacatcaat
accactaccaacggtgctgagattggtggagcgtttggtggtgaaaaggccactggcggt
ggccgggagtccggatcggatgcctggaaacagtactgcaagagggccactatcacagtc
aatcactcaggagagttggcctgtgcccagggtgtcgtcttcaatgtagagtaa

DBGET integrated database retrieval system