KEGG   Drosophila ananassae: Dana_GF11532Help
Entry
Dana_GF11532      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dan  Drosophila ananassae
Brite
KEGG Orthology (KO) [BR:dan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dan01002]
    Dana_GF11532
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dan04147]
    Dana_GF11532
   04090 CD molecules [BR:dan04090]
    Dana_GF11532
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dana_GF11532
Peptidases [BR:dan01002]
 Metallo Peptidases
  Family M2
   Dana_GF11532
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF11532
CD molecules [BR:dan04090]
 Proteins
  Dana_GF11532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 6494396
NCBI-ProteinID: XP_001960408
FlyBase: FBgn0088572
UniProt: B3MC43
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MRLPGKGVQLLLFLLLQMELTLGDSSRMSNHTANYEQTTKQILDKATARMRTIWDLKRRI
FLQLTAKGKSPLGGQALNGKQEVESETYRLQYELAANLSVVPVAELDDPLLRRRVQRMAK
LQLQGLRPKDYEQAKDLLRQTHNFVSGALVCPLEDCSARGPMSMDQQIVAKNRRTKLYDD
LLINWYAWRKAINEKETAKSTFIDFVRLLRIAATYNGHVTPSRTWYHHFDTENFQAEMET
VVWEIMPLYRELHAYLRHEVRIAYPKADTKSDGAIPAPVMDQILSQDWYPHQFFRTPHPS
KQHQLPSVHRRLEEVLVTPVKINRKAAEFFESLGLNHMSDNFYEKWSRRMKDDEGGPDCK
SQVYYFPPDVALRYCPKLDYKKMMQMHGTMAELQYNIYKRQLPFGLDTEPCPGFGAAMAE
TVILASGTARHLFRLHILLNDSLTEEQSLNRLFRMGVHTLVAVPQYFINDKFLVDVMDGR
IGVKDYNCAYWHLQDKFAGVQPPSQRNNRDFDLDFKFYRGMNPETSNTKKFLAEILGFQF
YRSFCLASGQYKPGDPDFPLHNCDFYDSKEAGKKMRDMMQLGATRHWRDVMEIATGERKL
SGRGILEYFAPLFTWLKERNKQLDIEPGWDADELCRKD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgccagggaagggggtgcagctgctgctgttcctgctgcttcagatggaactg
actttgggcgactcgagtcggatgtccaaccacaccgccaactatgagcagaccaccaaa
cagatcctcgacaaagcaaccgcccgaatgcgcaccatatgggacctgaagcgccgcatc
tttctccaactcacagcgaaaggaaagtctcctctgggagggcaggctttgaatgggaag
caggaagtggagtcggagacttatcgcctgcagtatgaactggctgccaatctcagcgtg
gtgccagtggccgagctcgatgatcctcttttgcgtcgacgggtgcagcggatggccaaa
ctgcagctgcagggcctgcgccccaaggattacgaacaggccaaggacctgctcaggcaa
acacacaactttgtgagcggggcgctggtgtgtcctctggaggactgctctgctcgaggc
cccatgtccatggaccagcagatagtggcaaagaaccggagaacaaagttgtacgacgat
ctgctgataaactggtacgcctggcgcaaagccatcaacgagaaggagactgccaagtcc
acgttcatagactttgtgcgacttctgaggatcgctgccacctacaatgggcatgtgact
ccgtcccgcacctggtaccaccacttcgacaccgagaacttccaggcggagatggagact
gtggtgtgggaaatcatgccactgtaccgggagctgcacgcctacctgcgccacgaggtg
cgcatcgcctatcccaaggcagacacaaagagcgatggcgccattccggcccccgttatg
gaccagatcctttcgcaggactggtatccgcaccagttctttcgcaccccccatcctagt
aagcagcaccagcttccctccgtccatcgccgcctggaggaggtcctggttacgcccgta
aaaatcaatcggaaagccgccgagttctttgagtccctcggactcaaccacatgtcggat
aacttctacgagaaatggtcacggcggatgaaggacgacgaaggtggccccgactgtaag
tcgcaagtgtactattttccgccggacgtggctctccggtactgtcctaagctggactac
aaaaaaatgatgcaaatgcacgggactatggcggagctccagtataatatttacaagcga
cagttgccctttggcctagacactgagccgtgtcctggattcggcgcagccatggcggag
acggtaatcctcgcctcgggcactgcccgccatcttttccgccttcacattctcctgaac
gacagcctcacagaggagcagtctctaaaccggctctttcggatgggagtgcacacactg
gttgcagtgcctcagtacttcatcaatgacaagttcctggtcgacgtcatggacgggaga
atcggagtgaaggactacaactgcgcctactggcatctgcaggacaagttcgccggagtg
cagcctccttcgcagcgcaacaacagggactttgacttggactttaagttctaccgcggg
atgaatccggaaacatctaacacaaaaaaatttttggccgaaatcttgggcttccagttc
taccgctccttctgcctcgctagtggccagtacaaacctggggatccggacttcccgctg
cacaactgtgacttctatgacagcaaggaggcgggcaagaagatgcgagacatgatgcag
ttgggggccacacggcattggcgggatgttatggagatagccaccggggagaggaagttg
agtggacgcggcattctggagtacttcgcgccactcttcacctggctgaaggagcggaac
aagcagctggatatcgaaccaggctgggacgccgacgaattgtgtcgaaaagattaa

DBGET integrated database retrieval system