KEGG   Drosophila ananassae: Dana_GF12360Help
Entry
Dana_GF12360      CDS       T01059                                 

Gene name
Dana_Mal-A2
Definition
(RefSeq) maltase A2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dan  Drosophila ananassae
Pathway
dan00052  Galactose metabolism
dan00500  Starch and sucrose metabolism
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dana_GF12360 (Dana_Mal-A2)
   00500 Starch and sucrose metabolism
    Dana_GF12360 (Dana_Mal-A2)
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dana_GF12360 (Dana_Mal-A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 6495211
NCBI-ProteinID: XP_001958841
FlyBase: FBgn0089397
UniProt: B3MFY1
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MPKWTHLGLVAFLLLSAATAGAADIDWWENAALYQIYPRSFQDSDGDGIGDLKGITSRLG
YLKEIGITATWLSPIFTSPMSDFGYDISNFYDIDPIFGTLSDFDALIVEAKSLGVKIILD
FVPNHSSDENEWFEKSVNREEGYDDFYVWDDGKLNEVTGEREAPSNWISVFGGPMWTWNE
KRQQYFLHQFQVKQPDLNFTNPMVREHMLDVLKFWLDRGVDGFRIDAVPHIYEKREANGS
YPDEPISGWSNNPEAYDYHDHIYTKDQPATVDLMYEWRAYLDAYQAENGGDSRVLLAEAY
SSVETLSAYFGNSTNLGTQLPMNFQLMYLDGYSTARDVVGSIDYWMNTMWRDHQTANWVI
GNHDTIRVADRMGAHKVDLLNVIVNALPGASVTYYGEEIGMSNVEIACTGDSCEDRDGER
TPMQWTPGQNADFSSGETTWLPVNPDYVRYNVQTERGVARSSLNIFKRLQALKSSSAFLS
FKEEGGFSYEAVTEQVLQIIRTNKISEEYRILVNMGNNMEILDGLDSKTYEYVLVTAYSP
RYPGNTVNLKERIILMPYEAVVLRWHA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtggacacatctcggcctggtggcattccttctgctttccgccgcaacggcg
ggtgctgccgacattgattggtgggagaacgccgccttgtaccagatttacccgcgctcc
ttccaggacagcgatggcgatggtatcggcgacctgaaaggcatcacttcccggctgggc
tacctcaaggaaatcggcatcacggccacctggctgtcacccattttcacctcgcccatg
tcggactttggttacgacatctccaacttctacgacatcgacccgatcttcggcactcta
tcagacttcgatgccctgatcgtcgaggccaagtccctgggcgtaaaaatcattttggac
tttgtgcccaatcattcgagcgatgagaacgagtggttcgagaagtcggtgaaccgcgag
gagggatacgacgacttctatgtctgggatgacggaaagctgaacgaggttacgggcgag
agggaagcaccttccaactggatctcagtgtttggtggacccatgtggacgtggaacgag
aagcgccagcagtactttctacaccagttccaggtgaagcagcccgacctcaacttcacc
aacccgatggtacgggagcacatgctcgacgtgctaaaattttggctggatcgtggtgtg
gatggattccgtatcgatgcagtgccccacatctatgagaagcgagaagccaacggttcg
tatccggatgagccaataagtggctggagcaataacccggaggcctatgactaccacgac
cacatctacaccaaggaccagccggccacagtagatctgatgtatgaatggcgggcctat
ttggatgcctatcaggcggagaatgggggcgattcacgggtgcttctggctgaagcttac
tcctccgtggaaactttaagcgcttactttggaaacagcaccaacctgggcactcagcta
cccatgaacttccagctgatgtacctggatggctactccaccgccagggatgtggtagga
tccatcgactactggatgaacaccatgtggagggatcatcagacggccaactgggtgatc
ggaaaccatgatactattcgggtggccgatcgtatgggagctcacaaggtggacctccta
aatgtgatagttaacgccctgccaggagcatcagttacgtactacggcgaggagattggt
atgtccaacgtagaaatcgcgtgcactggcgactcctgcgaggatcgtgatggagagcgg
acacccatgcagtggacaccaggacagaacgctgatttttcttcgggtgagacaacgtgg
ttgcccgtgaacccagactacgtaaggtacaatgtccagactgaacggggagtcgcacga
tcctcgttgaacatcttcaaaagactccaggcattgaagagtagctccgcctttctgtct
ttcaaggaagagggaggcttctcctatgaagcggtcacagaacaggttctgcagatcatt
cgtaccaacaaaatcagcgaggaatatcgaattctggtaaacatgggcaacaacatggag
atcctagatggcctggactccaaaacctacgaatatgtcctggtcactgcttactcacca
cgttatccaggcaacactgttaacctaaaagagagaattattcttatgccatacgaggcg
gtggttttacgttggcatgcatga

DBGET integrated database retrieval system