KEGG   Drosophila ananassae: Dana_GF12396Help
Entry
Dana_GF12396      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dan  Drosophila ananassae
Pathway
dan04146  Peroxisome
dan04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dana_GF12396
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dana_GF12396
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dana_GF12396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD DUF43
Motif
Other DBs
NCBI-GeneID: 6495246
NCBI-ProteinID: XP_001958767
FlyBase: FBgn0089433
UniProt: B3MFB5
LinkDB All DBs
Position
Unknown
AA seq 210 aa AA seqDB search
MLRLLATLALCATICSAAQTRNLPIQAIAYVSGPEVKGNVTFTQNDCGQNVHVRIQLEGL
KEGKHGFHIHEKGDLSNGCTSMGGHYNPDKVDHGAPSDNVRHVGDLGNLDVNSTGKIDIT
YTDTVITLTGVRTIIGRGVVVHEDEDDLGLGNHTDSKKTGNAGGRIACGVIGINSDVDEW
PCRTGGAGVLRNSLSILTVVVALFLASSIN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgacttttggctaccctggctctgtgtgccacaatttgctctgccgcccagacg
cgcaacctgccgatacaggccatcgcctatgtgagcggaccggaggtcaagggcaatgtt
actttcacccaaaacgattgtggccagaatgtccatgtccgcatccaactggagggcctc
aaggagggcaagcacggcttccacattcacgagaagggagatctgagcaacggctgcacc
agcatgggtggtcactacaatcccgataaggtggatcatggagcacctagcgataatgtc
cgacatgtcggtgatctgggtaatctggatgtgaactccactggcaaaatcgacattacc
tacacggataccgtgattacccttactggcgttcgtaccatcattggtcgcggcgttgtc
gtccacgaagatgaagatgatctgggtctgggcaaccatacggattccaagaagactggc
aacgcaggcggacgaattgcctgcggggttattggtatcaactcggacgtcgacgagtgg
ccatgccggacaggtggcgccggtgtcctgcgcaactctctttccattctgaccgttgta
gtagctctctttttggccagcagcataaactaa

DBGET integrated database retrieval system