KEGG   Drosophila ananassae: Dana_GF12545Help
Entry
Dana_GF12545      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dan  Drosophila ananassae
Pathway
dan04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dan00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dana_GF12545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dan01002]
    Dana_GF12545
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dan04147]
    Dana_GF12545
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dana_GF12545
Peptidases and inhibitors [BR:dan01002]
 Serine peptidases
  Family S1: chymotrypsin family
   Dana_GF12545
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF12545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6495395
NCBI-ProteinID: XP_001958747
FlyBase: FBgn0089582
UniProt: B3MF95
LinkDB All DBs
Position
Unknown
AA seq 273 aa AA seqDB search
MSRILVAVCLVLGVSCSLADPLYRNDEVEVPRLDGRIVGGQDTSILQYPYQISMRLRGNH
RCGGTVVATNIIVSAAHCVNTLTTVANLTIVAGSTRIWNVEEKQQELAVRQIIIHPNYRT
LNNDYDAAILILDGDFEYSDAIQPIPLATERPEHDTEVVVTGWGTTSEGGNISNILQEVF
VNVVENTECKKAYSFMLTSRMLCAAVTGGGKDACQGDSGGPLVLNKELLGIVSWGTGCAR
ETKPGVYCSVADVHDWLEETIKEYSVVGKISFL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggattttggtcgcggtttgcttggtgctgggagttagctgctccctggcggat
cccctctaccggaacgatgaggtcgaggtgccacgactcgacggacgtattgttggcggt
caggacacgagcattctgcaatatccctatcagatctccatgcgattgaggggaaatcac
cgatgtggtggcaccgttgttgccacaaacattattgtcagtgccgcacattgtgttaac
accttgaccaccgttgccaacctgaccattgtggcgggatcaacgcggatttggaatgtg
gaggagaagcaacaggaactggccgtccgtcaaatcatcatccatcccaattataggact
ttaaacaacgattacgatgctgctatcctgattttggacggagactttgagtatagcgat
gccattcagcccattccgttagccacagagcggccggaacacgataccgaggttgttgtg
actggttggggcaccaccagcgagggcggcaacatctccaacatcctgcaggaggtcttt
gttaatgtggtggaaaacacggaatgtaagaaggcttattccttcatgctgaccagccgg
atgctttgtgcggcagtcacgggaggcggtaaggatgcgtgccagggcgactcaggcggt
cctttggtcctcaacaaggaactgctcggcatcgtgtcctggggaacaggatgtgcccgt
gaaactaagcctggagtctactgctcagtggccgatgtccatgattggttggaggagaca
atcaaagagtactcggttgtgggaaaaatatccttcttgtaa

DBGET integrated database retrieval system