KEGG   Drosophila ananassae: Dana_GF12871Help
Entry
Dana_GF12871      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dan  Drosophila ananassae
Pathway
dan03030  DNA replication
dan03410  Base excision repair
dan03420  Nucleotide excision repair
dan03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dana_GF12871
   03410 Base excision repair
    Dana_GF12871
   03420 Nucleotide excision repair
    Dana_GF12871
   03430 Mismatch repair
    Dana_GF12871
Enzymes [BR:dan01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dana_GF12871
    6.5.1.6  DNA ligase (ATP or NAD+)
     Dana_GF12871
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Dana_GF12871
DNA replication proteins [BR:dan03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Dana_GF12871
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Dana_GF12871
DNA repair and recombination proteins [BR:dan03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Dana_GF12871
   NER (nucleotide excision repair)
    Other NER factors
     Dana_GF12871
   MMR (mismatch exicision repair)
    Other MMR factors
     Dana_GF12871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2 UPF0128 Mob_synth_C
Motif
Other DBs
NCBI-GeneID: 6495717
NCBI-ProteinID: XP_001959430
FlyBase: FBgn0089905
UniProt: B3MCL8
LinkDB All DBs
Position
Unknown
AA seq 765 aa AA seqDB search
MQKSITSFFKRKSDVPDESPEPKKAPKIKTETEDTKKLLIKTEDESPKAKIKAKPEPMTV
DPPESPDAPKSVKVEKDTENKPAAANDAKNESDTENKEADRKVTTIGLVSTSKDGKEDAE
NYDPSKDSYHPLKNAYWASKKVTPYLALARTFQVIEETKGRLKMIDTLSNYFCSVMLVSP
SDLVPSVYLSINQLAPAYEGLELGVAETTLMKAICKATGRNLAHIKSQTQLIGDLGIVAE
QSRVSQRMMFQPAPLNIRDVFRKLREIAKISGQSKMDLVYNVFVSCRSSEARFFIRSLIG
KLRIGIAEQSLLTALAIALVKKNHIGDCKASKVPEAYKDEIAETTLLLKTAYSQCPNYDI
IIPAILEYDIKELQERCPMHPGMPLRPMLAQPTKGVHEVFERFGGMHITCEWKYDGERAQ
IHCNEKGEISIFSRNSENNTAKYPDLIARSKNFLKCPVESYIIDSEIVAWDVERKQILPF
QVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVTKPLSERRKLLNEHFQEVEGEWQF
ATALNTNDIDEVQQFLEESVKGNCEGLMVKTLDQEATYEIAKRSRNWLKLKKDYISNVGD
SLDLVVIGGYKGKGKRTGTYGGFLLACYDTENEEYQTICKIGTGFTDEDLQTHSEFLGKH
VISSAKSYYRYDSSLEPDHWFEPVQVWEIKCADLSLSPIHRAAIGIVDGERGISLRFPRF
IRIRDDKNSENATDANQVAHMYQSQDLVKNNQKTLTQTDLEDEFY
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtccataacatcctttttcaaaaggaaatctgatgttccagatgagtcgccg
gaaccaaagaaagctcccaagataaaaactgaaacagaagatacaaagaaactattaatc
aagactgaagatgagtcccccaaagctaaaattaaagcgaagccagaaccaatgactgtg
gatccaccagaatcacctgatgctccaaaaagcgtaaaggtggagaaggatacggaaaac
aagcctgcagcagccaatgatgcaaaaaatgagtcggacacagagaacaaagaagctgac
cggaaagtcacaaccatcggcctggtctccacgtcgaaggacggaaaagaggacgctgag
aactatgatccctcgaaagattcttaccatcctctcaagaatgcctactgggcgtccaag
aaagtgactccttacttggccttggctcggacatttcaagtcattgaagagacaaaaggg
cgcctgaaaatgatcgacacactgagcaattacttttgttcggtcatgttggtcagcccc
agtgatctggtgcccagcgtgtatctcagtattaaccaattggctcctgcctatgagggc
ttggagttgggagtggccgaaactacgctgatgaaagccatttgcaaagccaccggtcga
aacttggcgcacatcaaatcgcaaacacaacttattggcgacctgggcattgtggccgag
cagtcccgcgtttcccagcgcatgatgttccaacccgctcctttaaatattcgagatgtg
ttccgcaagcttcgggaaatcgccaaaatatcgggtcaatccaagatggatcttgtttac
aacgtctttgtgtcctgccgatcgtctgaggcccgcttcttcatccgctccctgatcggc
aagctgcgaattggcattgccgagcagagtttgttgacggctttagccattgcgttggtc
aagaagaatcacatcggtgactgcaaagccagcaaagtgccagaagcttacaaagatgaa
attgcagagactacgttgctgctgaaaacagcctacagtcaatgtcccaactacgacata
attattcctgccattctggagtatgatattaaggaacttcaagaacgttgccccatgcat
cccggcatgcccctgcgacctatgctggcgcagcccactaagggtgttcacgaggtcttc
gaaagattcggaggcatgcacattacgtgcgagtggaaatacgacggagaacgggcccag
attcactgcaatgagaagggggagataagcatattctccaggaactctgaaaacaacaca
gctaagtatccggatctgattgccagaagcaagaacttcctcaagtgcccagtggaatcc
tatataatagacagtgaaatcgttgcctgggatgtggaacgaaagcaaatcctgcccttc
caagtgctaagcactcggaaaagaaagaacgtagatattgaagaaatcaaagttcaagtc
tgcgtctatatattcgatctcctgtacataaatggcacggccttggtgacaaagcctctg
tccgagcgtcgaaaactactcaatgagcattttcaagaagtcgaaggggagtggcagttc
gcgactgcattaaacactaacgatatagatgaggtgcaacagtttctagaggaatcggtt
aaaggtaactgtgagggtcttatggttaaaacactggatcaggaagcaacctacgagatc
gcaaagagatctaggaactggcttaagcttaaaaaggattacatctccaatgtgggcgac
tccctggatctcgtcgtgattggcggctacaaaggcaagggcaagagaactggcacctac
ggtggctttttattggcttgctacgataccgaaaacgaggaataccagaccatctgcaaa
attggaacaggtttcaccgacgaggatctgcagacacattccgaatttttgggaaaacat
gtaataagcagtgccaagtcctactacagatacgactctagcctggagccggaccactgg
ttcgaaccggtgcaagtgtgggagatcaagtgtgctgatctgtctctcagcccgatacat
cgggcagccattggtatcgttgatggggaacgcggcatttcactgcgattccccagattt
attcgcatcagagacgacaagaacagcgagaatgccacagatgcgaatcaggtggcgcac
atgtaccagtcccaagacctggtgaagaacaaccaaaaaaccctaacacaaacggattta
gaggatgagttctactga

DBGET integrated database retrieval system